Broccoli + Eggs, 😮 Didn't think that it will be this much amazing || Broccoli Omelette recipe

Поділитися
Вставка
  • Опубліковано 17 січ 2020
  • #broccoliomlette #broccolirecipe #omelette #tastyhours
    #lchfrecipe #ketorecipe
    #tortilla
    Other broccoli recipies
    ***********************
    1. • 🥦 Broccoli Crepes / Un...
    2. • Creamy Broccoli Shrimp...
    3. • 🥦 Garlic Broccoli Reci...
  • Навчання та стиль

КОМЕНТАРІ • 532

  • @jrch5563
    @jrch5563 3 роки тому +19

    I love the birds instead of the music and the sound of chopping and noises from the kitchen while preparing the food. Much more relaxing and less busy noise.

  • @rahulvidhate23
    @rahulvidhate23 3 роки тому +235

    No waste of time in intros, no off topic talks, no stupid music.
    Straight to the point, awesome recipe, and peaceful ambient background sound.
    Instant like and sub👍

    • @TastyHours
      @TastyHours  3 роки тому +8

      Thank you 😊

    • @ranjitdesai5254
      @ranjitdesai5254 3 роки тому +9

      Couldn't agree more!

    • @markp4767
      @markp4767 2 роки тому +1

      Please pleaseeee next time also give Measurements in Metric, given those are universal measurements on this planet, rather than just a country or 2. But this is such simple brilliant and healthy recipie to include fresh veggie. I also add some grated Parmeggiano reggiano, or adapt other ingredients into it like sun dried tomatoes or olives. Thanks for this 🖖🏾

    • @rogerforest1729
      @rogerforest1729 2 роки тому

      i know im asking randomly but does any of you know a tool to get back into an instagram account?
      I stupidly forgot my account password. I would appreciate any tricks you can give me!

    • @danecalvin3339
      @danecalvin3339 2 роки тому

      @Roger Forest Instablaster ;)

  • @BiSAYANGiGAT
    @BiSAYANGiGAT 2 роки тому +5

    Undeniably healthy and delicious at the same time

  • @tatafouzia3543
    @tatafouzia3543 2 роки тому

    Looks délicieux yummy mmmy brocoli wow beautiful recipe blz connecte
    Thank you so much welcome

  • @kajalsingh9554
    @kajalsingh9554 3 роки тому +46

    This looks amazing. I have broccoli, and will be making this tomorrow for lunch. I may add some cheese. thank you for making this video.

  • @KayDejaVu
    @KayDejaVu 2 роки тому +7

    I made this with Just Egg and it was good. I am not totally vegan but love the option to omit eggs. So much you can add to this.

  • @KhadidjaRcettes.s
    @KhadidjaRcettes.s 3 роки тому

    salut merci pour le partage+1like 👍🌹 🔔🤝🙌

  • @Raed10001
    @Raed10001 3 роки тому

    Amazing, thanks for sharing 🌹

  • @RecipesbyNabilMum
    @RecipesbyNabilMum 2 роки тому

    Sooooo yummy recipe Just wow yummy recipe 👌👌👌❤️❤️❤️❤️

  • @YummydayKorea
    @YummydayKorea 4 роки тому +1

    맛있겠어요 Yummy😋

  • @AliyahandMommyLDR
    @AliyahandMommyLDR 4 роки тому +9

    wow omelette broccili looks yummy. i must try this too

  • @PiusSpace
    @PiusSpace 4 роки тому +1

    Wowwww lovely and healthy combination

  • @saravlogs986
    @saravlogs986 3 роки тому

    Wow looks very nice

  • @deliciouscookingvlog8261
    @deliciouscookingvlog8261 2 роки тому

    Waw sooo Good.. Love to try this

  • @SameenasCookery
    @SameenasCookery 4 роки тому +3

    wow!! very healthy protein rich recipe

  • @dskitchen9190
    @dskitchen9190 4 роки тому +2

    Great looking omelette 😍😍😍 looks yummy and healthy 👍🏻👍🏻👍🏻

  • @rmnathan5923
    @rmnathan5923 3 роки тому

    Very nice n delicious.... Tq

  • @phoebezhong967
    @phoebezhong967 2 роки тому

    Thanks for ur sharing ❤️

  • @cookunnyne
    @cookunnyne 4 роки тому +2

    완전 대만족 레시피입니다~~
    Broccoli and egg!!! What a unique recipe♡♡♡

  • @roselilly4897
    @roselilly4897 4 роки тому +16

    Great recipe! Perfect way to get in vegetables! 👍👍

  • @fabulousirene
    @fabulousirene 4 роки тому +5

    Awesome recipe. Thank You so much for sharing dear and have a wonderful weekend dear

  • @sabasaba1682
    @sabasaba1682 3 роки тому

    Amazing. Soo delicious

  • @DINNERUSA
    @DINNERUSA 2 роки тому

    looks so yummy

  • @DastarKhawanCooking
    @DastarKhawanCooking 4 роки тому +1

    Very delicious and healthy recipe 👍🌹

  • @dianeely9729
    @dianeely9729 3 роки тому

    Yummy keep those quick n easy meals coming.

  • @naeemahmed2892
    @naeemahmed2892 2 роки тому

    Excellent and maked short time

  • @almaztsegaye8791
    @almaztsegaye8791 2 роки тому

    Thank your 4 sharing

  • @DeCookingTouch
    @DeCookingTouch 3 роки тому

    very nice presentation and looks yummy

  • @EMELIASKITCHEN
    @EMELIASKITCHEN 4 роки тому +1

    Looks delicious

  • @minutestocook
    @minutestocook 4 роки тому +2

    👍 looks delicious 😋 & simple

  • @healthy_foodcooking
    @healthy_foodcooking 2 роки тому

    WOW nice I will try it

  • @ShielaMarieJacinto
    @ShielaMarieJacinto 2 роки тому

    Healthy recipe, I will try it👍

  • @Mavszonetv
    @Mavszonetv 4 роки тому +1

    wow my friend this egg and broccoli look so awesome very colorful

  • @kishorerama1430
    @kishorerama1430 2 роки тому

    Wow healthy recipe

  • @cookwithjyoti3730
    @cookwithjyoti3730 4 роки тому +1

    Very healthe n tasty...

  • @palobar9974
    @palobar9974 3 роки тому +1

    Excellent! Thank you for sharing this recipe.

  • @simplecooking192
    @simplecooking192 4 роки тому +6

    Colorful , healthy and super yummy omelette. I must try cooking this too. big likes!

  • @chantaltulliez8066
    @chantaltulliez8066 3 роки тому +1

    shall make it looks delicious and healthy...thank you for sharing...

  • @recipesforall9780
    @recipesforall9780 4 роки тому +1

    Wonderful omelette
    liked it

  • @destinationdero
    @destinationdero 4 роки тому +5

    Looks so good friend. like 43

  • @CookingSkillzz
    @CookingSkillzz 4 роки тому +2

    Yumm 😋 i really lk broccoli 🥦

  • @glendaliquiran
    @glendaliquiran 2 роки тому

    i wanna try this healthy and simple dish, thanks for the new idea.

  • @CA-sj6oo
    @CA-sj6oo 3 роки тому +1

    Omg yummy looking!

  • @carlsapartments8931
    @carlsapartments8931 3 роки тому

    awesome... i'm hungry

  • @fuugawa741
    @fuugawa741 3 роки тому

    I must try this.. Tq

  • @harshithaartscrafts
    @harshithaartscrafts 4 роки тому

    It looks very colourful

  • @neetaskitchen1857
    @neetaskitchen1857 2 роки тому

    Looks healthy tasty recipe big lykee 👌 thanks

  • @varshikaskitchenlifestyletamil
    @varshikaskitchenlifestyletamil 4 роки тому

    Delicious egg with broccoli....Yum....Yum....

  • @hevesozyilmaz2875
    @hevesozyilmaz2875 3 роки тому +1

    Looks delicious plus appropriate for the diets, thanks so much

  • @GraftingTactick
    @GraftingTactick 3 роки тому +1

    Top shelf my friend, it looks so delicious 👍👍👍

  • @NovelKitchen
    @NovelKitchen 2 роки тому

    Healthy broccoli Omlette

  • @WonderMomOfficial
    @WonderMomOfficial 4 роки тому +1

    Like 👍👍 very tasty and healthy recipe 😋😋😋

  • @wellbeinglife6037
    @wellbeinglife6037 4 роки тому +15

    Wow ~~~
    Looks very healthy and delicious food.
    Thank you my friend.

  • @khoetranst..4391
    @khoetranst..4391 3 роки тому

    very good .yummy yummy .i like it .Thanks for sharing .

  • @cookingmeimei8465
    @cookingmeimei8465 2 роки тому

    wow so good yummy 👍👍💓💓🤤🤤🤤

  • @SumedhaManabaranaKandy
    @SumedhaManabaranaKandy 3 роки тому +1

    So easy.... brilliant..💥✍️

  • @rubychannel1113
    @rubychannel1113 2 роки тому

    Wow tq, awesome recipe😘👌👍

  • @specialkhanay2359
    @specialkhanay2359 4 роки тому +1

    Like #35👍😍
    Very nice video great share yummy and delicious recipe. I will definitely try to make it . Keep up the good work . You are a great cook 👩‍🍳 💙💚❤️😘🥰💕

  • @jekusinatv6958
    @jekusinatv6958 3 роки тому +5

    This recipe looks so good, and also healthy. I will try this next time. Thank you for sharing this recipe

  • @ayemi2556
    @ayemi2556 2 роки тому

    Good looking,that must be very tasteful.Thanks for sharing.

  • @sumaskitchen8269
    @sumaskitchen8269 3 роки тому

    Nice recipe

  • @flavoursshore8600
    @flavoursshore8600 4 роки тому

    Wooww.. healthy n yummy recipe

  • @newlifethaius4281
    @newlifethaius4281 3 роки тому

    This amazing idea. I’m going to make it thanks for sharing .

  • @harilal1441
    @harilal1441 3 роки тому

    Wow... This is a very good recipe for me.

  • @jasinthagunawardana328
    @jasinthagunawardana328 3 роки тому

    Great recipe 🌹

  • @Thottavadii
    @Thottavadii 4 роки тому +1

    Wow this looks so delicious 👌👌I must try it 😋😋

  • @limewalk6719
    @limewalk6719 3 роки тому

    Great recipe. Thanks for sharing :)

  • @jamshirana7747
    @jamshirana7747 4 роки тому +1

    ഓംലറ്റ് റെസിപ്പി സൂപ്പർ ആയിട്ടുണ്ട് 😋😋

  • @Dhspat
    @Dhspat 2 роки тому +1

    Yummy. ☘️☘️☘️☘️☘️

  • @KoreaWalkingVlog
    @KoreaWalkingVlog 3 роки тому

    Looks so delicious. I will try to make it. Thanks for nice video.

  • @jamalalexandar2583
    @jamalalexandar2583 2 роки тому

    Amazing videos

  • @parviish
    @parviish 4 роки тому +1

    Wow looks so yummyy😋

  • @dhruvbhatt1876
    @dhruvbhatt1876 3 роки тому

    Good idea , thanks chef.

  • @nooor1120
    @nooor1120 3 роки тому

    Yummy
    Thanks

  • @AmysWorld4u
    @AmysWorld4u 4 роки тому +1

    Looks good!

  • @vio5054
    @vio5054 3 роки тому

    👍🏾nice one I'll try it

  • @pk2030
    @pk2030 2 роки тому

    I will try this👍😋

  • @AdibaFoodzIndia
    @AdibaFoodzIndia 4 роки тому +1

    Awesome preparation...👍... TFS

  • @simplengbuhayngmaybahay5369
    @simplengbuhayngmaybahay5369 3 роки тому

    very healthy thank you for sharing I will try this support and connected

  • @independentnews308
    @independentnews308 3 роки тому +1

    Excellent food

  • @chafrewilcha
    @chafrewilcha 3 роки тому +14

    This was very tasty!! I've found another great addition for breakfast ... and as a side for lunch or dinner ... or for a late night healthy snack. Thanks a million!

  • @FilipinaVanLifeAubry
    @FilipinaVanLifeAubry Рік тому

    I got broccoli I should try this. Thanks for sharing this recipe

  • @sumathyperumal605
    @sumathyperumal605 3 роки тому

    Wow looks amazing !

  • @pmehta4452
    @pmehta4452 2 роки тому

    Bravo!

  • @mirzaraziabaig1800
    @mirzaraziabaig1800 3 роки тому

    Very very nice

  • @MaltsTime
    @MaltsTime 3 роки тому

    Yummy & healthy, love it 💖👌

  • @memekjunior3518
    @memekjunior3518 3 роки тому

    Ok I will try this for breakfast

  • @subhanallahrabiyakitchen
    @subhanallahrabiyakitchen 4 роки тому +1

    big like 13 .......Owwwwwwwwwwwwwwwwwwwwwwwwwww this is really amazing recipe .... super Yummy mouthwatering recipe share gud work dear watched full tfs

  • @PoonamsKitchenMore
    @PoonamsKitchenMore 4 роки тому +1

    27th like yummy and healthy dear friend keep in touch 👍👍😋 😋👌 👌

  • @budekins542
    @budekins542 2 роки тому

    Definitely doing this!

  • @CookingSkillzz
    @CookingSkillzz 4 роки тому +1

    delicious omelette

  • @newhealthyhacks2148
    @newhealthyhacks2148 3 роки тому

    Awesome...!!

  • @arunaatozchannel9546
    @arunaatozchannel9546 2 роки тому

    Super 👌👌

  • @cookinghistory96
    @cookinghistory96 3 роки тому

    so nice

  • @MamatasPavilion
    @MamatasPavilion 4 роки тому +3

    Green Keto like diet ! superb omlette idea and the qty of broccoli you used is excellent , very healthy breakfast idea ! thanks for sharing, always enjoy watching you at work !

  • @gurdeepmaan4434
    @gurdeepmaan4434 3 роки тому

    Wow NYC respie 😇😇😋

  • @indianvlogandrecipe2482
    @indianvlogandrecipe2482 4 роки тому

    Very healthy and tasty 😋😋👌👌

  • @UhmMaRang
    @UhmMaRang 4 роки тому +21

    Hello.
    Your Broccoli Omelette
    The cooking recipe was so delicious.
    I'll go to the end of the video.
    I'll find you again next time.
    ^ _ ^ ~~

  • @salalathkoyatty3467
    @salalathkoyatty3467 4 роки тому

    super,😋

  • @delta201delta201
    @delta201delta201 3 роки тому

    Fantastic