Broccoli + Eggs, 😮 Didn't think that it will be this much amazing || Broccoli Omelette recipe

Поділитися
Вставка

КОМЕНТАРІ • 532

  • @jrch5563
    @jrch5563 3 роки тому +21

    I love the birds instead of the music and the sound of chopping and noises from the kitchen while preparing the food. Much more relaxing and less busy noise.

  • @rahulvidhate23
    @rahulvidhate23 3 роки тому +236

    No waste of time in intros, no off topic talks, no stupid music.
    Straight to the point, awesome recipe, and peaceful ambient background sound.
    Instant like and sub👍

    • @TastyHours
      @TastyHours  3 роки тому +8

      Thank you 😊

    • @ranjitdesai5254
      @ranjitdesai5254 3 роки тому +9

      Couldn't agree more!

    • @markp4767
      @markp4767 3 роки тому +2

      Please pleaseeee next time also give Measurements in Metric, given those are universal measurements on this planet, rather than just a country or 2. But this is such simple brilliant and healthy recipie to include fresh veggie. I also add some grated Parmeggiano reggiano, or adapt other ingredients into it like sun dried tomatoes or olives. Thanks for this 🖖🏾

    • @rogerforest1729
      @rogerforest1729 3 роки тому

      i know im asking randomly but does any of you know a tool to get back into an instagram account?
      I stupidly forgot my account password. I would appreciate any tricks you can give me!

    • @danecalvin3339
      @danecalvin3339 3 роки тому

      @Roger Forest Instablaster ;)

  • @kajalsingh9554
    @kajalsingh9554 3 роки тому +46

    This looks amazing. I have broccoli, and will be making this tomorrow for lunch. I may add some cheese. thank you for making this video.

  • @BiSAYANGiGAT
    @BiSAYANGiGAT 2 роки тому +6

    Undeniably healthy and delicious at the same time

  • @KayDejaVu
    @KayDejaVu 2 роки тому +7

    I made this with Just Egg and it was good. I am not totally vegan but love the option to omit eggs. So much you can add to this.

  • @caminodesantiago9376
    @caminodesantiago9376 4 роки тому +3

    looks easy and delicious, low carbs , I will try it tomorrow

  • @ayemi2556
    @ayemi2556 3 роки тому

    Good looking,that must be very tasteful.Thanks for sharing.

  • @harilal1441
    @harilal1441 3 роки тому

    Wow... This is a very good recipe for me.

  • @aiit-n3v
    @aiit-n3v Рік тому

    Bravot c'est une très bonne cuisine bon courage

  • @glendaliquiran
    @glendaliquiran 2 роки тому

    i wanna try this healthy and simple dish, thanks for the new idea.

  • @chantaltulliez8066
    @chantaltulliez8066 3 роки тому +1

    shall make it looks delicious and healthy...thank you for sharing...

  • @aayushscreativity3842
    @aayushscreativity3842 3 роки тому

    Unique..I will definitely try

  • @naeemahmed23999
    @naeemahmed23999 2 роки тому

    Excellent and maked short time

  • @cookunnyne
    @cookunnyne 5 років тому +2

    완전 대만족 레시피입니다~~
    Broccoli and egg!!! What a unique recipe♡♡♡

  • @veenamanjunathan3109
    @veenamanjunathan3109 3 роки тому

    Great and delicious .. looks puffy and yummy

  • @khoetranst..4391
    @khoetranst..4391 3 роки тому

    very good .yummy yummy .i like it .Thanks for sharing .

  • @neetaskitchen1857
    @neetaskitchen1857 3 роки тому

    Looks healthy tasty recipe big lykee 👌 thanks

  • @shagunmittal5551
    @shagunmittal5551 2 роки тому

    Loved it. Came out very nice

  • @radhikaan2863
    @radhikaan2863 3 роки тому

    Vgud recipe..I prepared this delicious item..my whole family becomes fans of it.

  • @phoebezhong967
    @phoebezhong967 3 роки тому

    Thanks for ur sharing ❤️

  • @RecipesbyNabilMum
    @RecipesbyNabilMum 2 роки тому

    Sooooo yummy recipe Just wow yummy recipe 👌👌👌❤️❤️❤️❤️

  • @tahasorkati5936
    @tahasorkati5936 2 роки тому

    this is nice N healthy thanks

  • @Exiria
    @Exiria 3 роки тому

    Beautiful color

  • @rmnathan5923
    @rmnathan5923 3 роки тому

    Very nice n delicious.... Tq

  • @bluelilly22222
    @bluelilly22222 4 роки тому +3

    It's looking like an beautiful jewel.. 👌👍❤😋😋😋

    • @TastyHours
      @TastyHours  4 роки тому +1

      Thank you 😊 👍🏻

    • @thecatofjoy3686
      @thecatofjoy3686 3 роки тому +1

      It's an Emeraldette. An emerald omelette ☺️💚🍳🤤

    • @bluelilly22222
      @bluelilly22222 3 роки тому

      @@thecatofjoy3686 yes

  • @aradhana_official8504
    @aradhana_official8504 2 роки тому

    I tried this today come out excellent👍👏💖tw for the best recipe

  • @carlsapartments8931
    @carlsapartments8931 3 роки тому

    awesome... i'm hungry

  • @FilipinaVanLifeAubry
    @FilipinaVanLifeAubry 2 роки тому

    I got broccoli I should try this. Thanks for sharing this recipe

  • @stephylee7967
    @stephylee7967 10 місяців тому

    I just cooked this for my breakfast. It was so good and healthy!

  • @chafrewilcha
    @chafrewilcha 3 роки тому +14

    This was very tasty!! I've found another great addition for breakfast ... and as a side for lunch or dinner ... or for a late night healthy snack. Thanks a million!

  • @AliyahandMommyLDR
    @AliyahandMommyLDR 5 років тому +9

    wow omelette broccili looks yummy. i must try this too

  • @aliciauvangkitchen9880
    @aliciauvangkitchen9880 2 роки тому +1

    Greetings from Malaysia...
    Your broccoli omelette looks super delicious & nicely prepared... perfect for a healthy breakfast...thanks for sharing this great recipe...

  • @deliciouscookingvlog8261
    @deliciouscookingvlog8261 3 роки тому

    Waw sooo Good.. Love to try this

  • @simpleruralfood9544
    @simpleruralfood9544 3 роки тому +1

    Just Excellent !!
    Delicious ????
    Yummy ???
    Tasty ??

  • @kishorerama1430
    @kishorerama1430 3 роки тому

    Wow healthy recipe

  • @simplengbuhayngmaybahay5369
    @simplengbuhayngmaybahay5369 3 роки тому

    very healthy thank you for sharing I will try this support and connected

  • @elizabethdrummond9581
    @elizabethdrummond9581 4 роки тому

    VERY NICE AND HEALTHY

  • @rubychannel1113
    @rubychannel1113 3 роки тому

    Wow tq, awesome recipe😘👌👍

  • @independentnews308
    @independentnews308 3 роки тому +1

    Excellent food

  • @specialkhanay2359
    @specialkhanay2359 5 років тому +1

    Like #35👍😍
    Very nice video great share yummy and delicious recipe. I will definitely try to make it . Keep up the good work . You are a great cook 👩‍🍳 💙💚❤️😘🥰💕

  • @RizaDabon
    @RizaDabon 4 роки тому +1

    I will try this thanks for sharing

  • @MamatasPavilion
    @MamatasPavilion 5 років тому +3

    Green Keto like diet ! superb omlette idea and the qty of broccoli you used is excellent , very healthy breakfast idea ! thanks for sharing, always enjoy watching you at work !

  • @palobar9974
    @palobar9974 3 роки тому +1

    Excellent! Thank you for sharing this recipe.

  • @saravlogs986
    @saravlogs986 3 роки тому

    Wow looks very nice

  • @samaykulkarni5496
    @samaykulkarni5496 3 роки тому

    wow great. i liked the recipe when i tried it. thanks a lot

  • @Navaneetnavaneet
    @Navaneetnavaneet 3 роки тому +1

    Simple. Presentation so attractive. I was looking for a simple, easy to cook recipe. Thank you

  • @user-yv9cs6bs4u
    @user-yv9cs6bs4u 4 роки тому +3

    Ok looks very delicious and that’s made me get up and make my breakfast now.Thanks.

  • @Dhspat
    @Dhspat 2 роки тому +1

    Yummy. ☘️☘️☘️☘️☘️

  • @paulinecheng3004
    @paulinecheng3004 3 роки тому

    😋😋😋👍👍👍👍🤗🤗🤗😄😄😄 thx for sharing, this's my new 'discovery' . Wonderful!!

  • @KoreaWalkingVlog
    @KoreaWalkingVlog 3 роки тому

    Looks so delicious. I will try to make it. Thanks for nice video.

  • @maryngshwuling9916
    @maryngshwuling9916 3 роки тому

    Thanks for sharing this recipe 🌈

  • @nataliah4478
    @nataliah4478 3 роки тому

    it looks very good! i will try

  • @almaztsegaye8791
    @almaztsegaye8791 3 роки тому

    Thank your 4 sharing

  • @newlifethaius4281
    @newlifethaius4281 3 роки тому

    This amazing idea. I’m going to make it thanks for sharing .

  • @parviish
    @parviish 5 років тому +1

    Wow looks so yummyy😋

  • @jamalalexandar2583
    @jamalalexandar2583 3 роки тому

    Amazing videos

  • @roselilly4897
    @roselilly4897 5 років тому +16

    Great recipe! Perfect way to get in vegetables! 👍👍

  • @healthy_foodcooking
    @healthy_foodcooking 2 роки тому

    WOW nice I will try it

  • @libmananchannel
    @libmananchannel 5 років тому +1

    Nice cooking channel! Nice recipe! I enjoyed it very much!

  • @wellbeinglife6037
    @wellbeinglife6037 5 років тому +15

    Wow ~~~
    Looks very healthy and delicious food.
    Thank you my friend.

  • @livyintheskywithdragons
    @livyintheskywithdragons Рік тому

    Hmm looks real tasty, I’m going to try it! ⭐️⭐️

  • @JeanSimpleLife
    @JeanSimpleLife 3 роки тому

    love this.. must try with malunggay leaves :)

  • @SameenasCookery
    @SameenasCookery 5 років тому +3

    wow!! very healthy protein rich recipe

  • @PravisTasteAndTravel
    @PravisTasteAndTravel 5 років тому +1

    Very nice recipe, looking good 👍

  • @tatafouzia3543
    @tatafouzia3543 2 роки тому

    Looks délicieux yummy mmmy brocoli wow beautiful recipe blz connecte
    Thank you so much welcome

  • @mirzaraziabaig1800
    @mirzaraziabaig1800 3 роки тому

    Very very nice

  • @puspashreenayak6730
    @puspashreenayak6730 3 роки тому

    It looks yummy 😋 will make tomorrow

  • @Mavischosen
    @Mavischosen 5 років тому +1

    wow my friend this egg and broccoli look so awesome very colorful

  • @MsLuminous
    @MsLuminous 3 роки тому +1

    Super declicious!! I added 2 chopped green chilies. Enough to feed breakfast for 5 people if served with some bread. Thank you for this easy and delicious recipe!!

  • @DeCookingTouch
    @DeCookingTouch 3 роки тому

    very nice presentation and looks yummy

  • @vio5054
    @vio5054 4 роки тому

    👍🏾nice one I'll try it

  • @simplecooking192
    @simplecooking192 5 років тому +6

    Colorful , healthy and super yummy omelette. I must try cooking this too. big likes!

  • @danutahanyga4834
    @danutahanyga4834 3 роки тому +1

    Looks yam. I like the plate trick. Very clever. as is soaking broccoli in hot water. Brilliant.Thanks for posting :)

  • @KhadidjaRcettes.s
    @KhadidjaRcettes.s 3 роки тому

    salut merci pour le partage+1like 👍🌹 🔔🤝🙌

  • @limewalk6719
    @limewalk6719 3 роки тому

    Great recipe. Thanks for sharing :)

  • @WoderMomOfficial
    @WoderMomOfficial 5 років тому +1

    Like 👍👍 very tasty and healthy recipe 😋😋😋

  • @pk2030
    @pk2030 3 роки тому

    I will try this👍😋

  • @cookingmeimei8465
    @cookingmeimei8465 3 роки тому

    wow so good yummy 👍👍💓💓🤤🤤🤤

  • @katerowlands4398
    @katerowlands4398 2 роки тому

    Simply superb, and love the quiet and birdsong of the video, therapy bless you 😊

  • @ahammedarman9038
    @ahammedarman9038 5 років тому

    i am a big big fan of ur food recipes

  • @EricxYi
    @EricxYi 5 років тому +17

    Came out looking perfect! Super healthy and easy to make! Love a good omelette!

  • @PoonamsKitchenMore
    @PoonamsKitchenMore 5 років тому +1

    27th like yummy and healthy dear friend keep in touch 👍👍😋 😋👌 👌

  • @varshikaskitchenlifestyletamil
    @varshikaskitchenlifestyletamil 5 років тому

    Delicious egg with broccoli....Yum....Yum....

  • @aradhana_official8504
    @aradhana_official8504 2 роки тому

    Amazing💕😍

  • @Muzammil787
    @Muzammil787 3 роки тому +5

    Love it. Dr. Eric Berg must be very glad to see another Keto friendly food.

  • @bagusnisavlog9853
    @bagusnisavlog9853 3 роки тому

    Nice... always success your content

  • @anjucmohan
    @anjucmohan 3 роки тому +6

    I prepared this today morning and it was tasty... thank you for the recipe ❤️

  • @jasinthagunawardana328
    @jasinthagunawardana328 3 роки тому

    Great recipe 🌹

  • @loganathanalagarasan5592
    @loganathanalagarasan5592 3 роки тому

    The Rotated omelet style really awesome 👏

  • @magdanell7128
    @magdanell7128 3 роки тому

    Looks very nice, thank you. 👏🏻👏🏻💐💐💐💐💐

  • @ShielaMarieJacinto
    @ShielaMarieJacinto 3 роки тому

    Healthy recipe, I will try it👍

  • @pandiselviveeramani5550
    @pandiselviveeramani5550 3 роки тому

    Super I liked it

  • @DINNERUSA
    @DINNERUSA 2 роки тому

    looks so yummy

  • @fabulousirene
    @fabulousirene 5 років тому +5

    Awesome recipe. Thank You so much for sharing dear and have a wonderful weekend dear

  • @sandanammary3241
    @sandanammary3241 2 роки тому

    Thank you for recipe

  • @dianeely9729
    @dianeely9729 3 роки тому

    Yummy keep those quick n easy meals coming.

  • @rajamallaiahedla3843
    @rajamallaiahedla3843 3 роки тому

    Nice idea

  • @jekusinatv6958
    @jekusinatv6958 4 роки тому +5

    This recipe looks so good, and also healthy. I will try this next time. Thank you for sharing this recipe

  • @hanane.halgeria7832
    @hanane.halgeria7832 2 роки тому

    I liked and subscribed because you don't talk and u get straight to the point 😘

  • @친절한냥이온니
    @친절한냥이온니 5 років тому +15

    The color of the food was so pretty that I fell in love with it