Arunachalam Giri Pradakshanam || అరుణాచలం రాత్రి 2 గంటలకు గిరి ప్రదక్షణం
Вставка
- Опубліковано 30 лип 2023
- Arunachalam Giri Pradakshanam || అరుణాచలం రాత్రి 2 గంటలకు గిరి ప్రదక్షణం
Significance of Arunachalam Temple Giri Pradakshina
The act of walking around the hill in a clockwise direction, with the right side facing the object of adoration, is known as “Giri Pradakshina.”
Pradakshina signifies the removal of sins, fulfillment of desires, freedom from future births, and deliverance through knowledge (jnana).
According to Sri Ramana Maharshi, each step taken during Pradakshina brings increasing levels of happiness: one step for happiness in this world, two steps for happiness in heaven, and three steps for the bliss of Satyaloka.
During Pradakshina, one can choose to maintain silence (mouna), engage in meditation (dhyana), repeat the Lord’s name (japa), or participate in devotional singing (sankeertana), while constantly contemplating on God.
Siddhars, revered spiritual practitioners, are believed to still reside on the hill according to tradition.
The town of Tiruvannamalai features an octagonal structure due to the presence of eight lingams placed in eight directions.
The eight lingams are Indra Lingam, Agni Lingam, Yama Lingam, Niruthi Lingam, Varuna Lingam, Vayu Lingam, Kubera Lingam, and Esanya Lingam.
Recommended: Arunachalam Temple Complete Guide: How to Reach & Timings
Arunachalam Giri Pradakshina Full Details
The total Arunachalam Temple Giri Pradakshina distance covered to walk around the hill is 14km which takes 3hrs to 4hrs.
Preferably Arunachalam Temple Giri Pradakshina’s timings to walk would be 4:00 am, 4:00 pm, or 10 pm onwards.
Darshan may take 6 to 7 hours, be prepared to stand in long queue lines.
Giri Pradakshina can be performed any time in a year, but its auspicious on full moon days.
One can witness higher crowds during Full moon days.
Two pathways: outer pathway (commonly traveled) with Temples, Asta Lingams, Tirthams, and Shrines.
The inner path is available for Girivalam but closed due to security reasons.
The inner path passes through the forest and is covered with stones, making it difficult to walk without footwear.
Aunachalam Temple Giri Pradakshina Map Routes
You have to start your Arunachala Giri Pradakshina (girivallam) from Arunachaleswarar Temple, and then follow Ashta Lingas starting with Indra linga, Agni, Yama, Niruthi, Surya, Vayu, Kubera and finally Eesanya Linga.
Tips for Arunachalam Giri Pradakshina
Giri Pradakshina can be tiring, especially for those unaccustomed to daily walking.
Start early, preferably from 4 am onwards, for cooler temperatures and fewer crowds.
Some lingam temples along the way open after 5 am, so plan accordingly.
Stop at the Hanuman temple to see a 150-year-old Sanyasi in meditation for personal benefit.
Continuously gaze at the mountain while reciting the Siva mantra within oneself, particularly auspicious on full moon days.
Many people walk barefoot during the pilgrimage as spirituality is a personal experience.
Consider taking an auto tour the day before to familiarize yourself with the Girivalam route.
Read up on the proper way to complete the Girivalam for a fulfilling experience (agasthiar.com website).
Encounter sadhus living on the streets and sleeping under trees along the route.
The complete walk takes around 4 hours or more, with short stops at main Lingam temples en route.
చాలా చక్కగా వివరించారు సార్ ధన్యవాదాలు 🌹👌👌👌🌹
నీ అభినందనకి నేను కృతజ్ఞుడను 😊🙏
@@ashoktraveltale 🌹🙏🌹😊
చాలా ఓ పికగా తిరిగి అన్నలిం గముల వివరాలు మార్గం చూపించు కుంటూ వీడియో చేసి యు ట్యూబ్లో పెట్టారు చాలా సంతోషంగాఉన్నది.. పుణ్యం చే సుకున్నారు.. అరుణాచలశివుడు మనఁదరికి మోక్షం కలుగ చేయాలని ప్రార్దిస్తున్నాను. గైడెన్సీ బాగుంది..
అన్ని అరుణాచలేశ్వరుని ఆశీస్సులు, ధన్యవాదాలు
Arunacheleshwara thondaraga ne darshana bhaghyanni kalipimchu swami
L😊
అరుణాచల శివ 🙏🌺🕉️
అరుణాచల శివ🙏🌺🕉️
అరుణాచల శివ🙏🌺🕉️
Korika korakudadandi. Sankalpam chesukovali "pradakshanam baaga avvalani"
Korikalu automatic ga arunachaleshwarudu theerustaadu. Manaku em kaavaalo aayanaku telusu.
Nenu eppativaraku 5 sarlu velli pradashanam chesanu. Na life lo chala pedda changes vachai. Antha arunachaleshwarudi daya.
Recent ga monna vellanu. Yenni sarlu vellina malli malli vellanipistundi.
Arunachala shiva, Arunachala shiva, Arunachala shiva....
Correct ga chepparu.
It took 18years to make the Darshan very powerful
Nice explanation 😊
Thank you for the compliment 😊🙏
Hi
మీము 3/5/2024 రోజు గిరి ప్రదక్షణ చేసి దర్శనాం చేసుకున్నాము
చాలా బాగా జరిగింది
సూపర్ టెంపుల్❤
Om Arunachaleswara 🕉
Rush yela undindi Mam..?
Same andi,memu kuda 3/05/2024 early morning 3am ki start chesam7am ki complete chesaam so happy,enka 4 days ekkade vuntam
Om arunachaleswaraya om namah shivay
Om Arunachaleswara 🕉
Arunachal Shiva ❤️ Arunachal Shiva ❤️ Arunachal Shiva ❤️🙏🙏🙏🙏
Om Arunachaleswara 🕉
🙏Arunachala shiva🙏
మేం సాయంత్రం 5.15 కి బయలుదేరాము.రాత్రి 1.15 ఐంది.చెప్పులులేకుండా నడవడంవల్ల పాదాలు నెప్పులు వచ్చాయి.
ఓం నమఃశివాయ 🚩🚩🚩🚩🚩
🙏
Arunchala Shiva🙏🙏🙏🙏🙏 ne darsanam bhagyam chepinchu devuda ne giri pradikshana chepinchu devudaaa
Meru anukunnadi avvalani korukuntunanu, om Arunachaleswara 🙏
Om namashivaya 🙏🙏🙏🙏🙏🙏🙏🙏🙏🙏
Arunachala shiva 🙏🙏🙏
Thankyou so much brother
🙏🔱🕉️అరుణాచలేశ్వరాయ నమః🔱🙏
Thank you 😊
అరుణాచల శివ,
🙏
Arunachala siva🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻
Om Arunachaleswara 🕉
🙏🙏🙏🙏🙏🙏ఓం నమశ్శివాయ
🙏
The great temple pranaam jai ho jagath ke maatha pithaki jai ho
🙏
ఓం నమశ్శివాయ❤
🙏
Thanq so much sir
Now my feeling is like I'm in Arunachalam when watching this video
🙏 Arunachala Siva 🙏
🙏 Om Namah Shivaya 🙏
Always needs ur blessings
Siva Siva Siva
Sri Maatre Namaha
Thank you for the great compliment 😊🙏
Om Arunachalaya namah 🙏🙏
🙏
Chaala baaga chepparu. Nice bgm.
Arunachala shiva
Om. Namah shivaya
Shivaya namah om❤
Thank you
Om arunachala sivaya
🙏
Thank u brother🙏🙏🙏🙏🙏
Thank you 🙏
నేను రాత్రి తొమ్మిది గంటలకి ముద్దులు పెడితే తెల్లవారుజామున మూడున్నర అయ్యింది ఫస్ట్ టైం వెళ్లడం వల్ల తెలియక తెలిసిన వాళ్ళ కోసం ఆగి ఆగి వెళ్లడం వల్ల కొంచెం లేట్ అయింది ఉదయం 6 గంటలకు మళ్ళీ దర్శనానికి వెళ్ళాం సంవత్సరం క్రితం వెళ్లాను మెస్సి వీడియో చూడడానికి చూస్తున్న రేపు మళ్లీ వెళ్తున్నాం అరుణాచలం అరుణాచలం సంవత్సరం క్రితం మా అమ్మగారికి వెళ్లాను ఇప్పుడు మా హస్బెండ్ కి వెళ్తున్న ఓం నమశ్శివాయ ఓం నమశ్శివాయ ఓం నమశ్శివాయ❤❤
ఓం అరుణాచలేశ్వర 🙏🕉
Namaskaram ratiri pradakshinam girls ki safe aa na
Chala safe andi, no problem. Akada food and medical shops open lo untayi. Police patroling kuda untundi and chala mandi giri pradakshanam chestaru.
@@ashoktraveltale thank you
Muddulu kadu adi moddalu
sir,
గిరి ప్రదక్షిణ చేసే ముందు లగేజీని ఎక్కడ పెట్టాలో తెలియజేయండి.గ్రామీణ ప్రాంత ప్రజలకు ఎంతగానో ఉపయోగపడుతుంది.
Rooms, lockers untai. Don't worry
రూమ్ ఉంటాయి
Ramana aashramam ki eduruga....siva sannidi charitable trust undandi....telugu vaalladi..1500 rs ki room...siva sannidi ki theeskellandi ani chepthe auto vaallu theeskelthaaru....
Super Bro Thank You So Much
Thank you🙏
Om Arunachala shiva
Thank you 🙏
Thank you bro
Om namah shivaya 🙏🙏🙏
Thank you 🙏
సూపర్ గా chepparu thnqqq andi
Thank you 😊 🙏
Arunachaleswara tondaraga ne darshana bhagyam kaliginchu swamy🙏🙏🙏🙏🙏🙏🙏🙏🙏🙏🙏🙏🙏
🙏
Om arunachaleswara namaha day time lo ayethe Anni lingalu chudachu
Avunu, kani endalakalo velthe kaalu baga kaaluthayi.
Chala chala thanks andi
Thank you 😊
Exlent explanation boss
Thank you 🙏
Thank you andi
Thank you 😊🙏
అరుణాచలం శివ
🙏
Om namah shivaya
🙏
Om arunachaleshwaraya namaha
Thank you brother manchi usefull information iccharu
Thank you andi 😊
Om Arunchal shivaya namaha
🙏
Super bro nice guidence
Thank you 😊🙏
Chala baga chupimcharu
Thank you 🙏
Arunachal Siva arunachal Siva arunachal Siva arunachal Siva arunachal Siva
Om Arunachaleswara 🕉 🙏
Chala bagundi. Thanks for the valuable information.
Thank you 🙏
Nice Thank you.
Thank you sir ☺️ 🙏
Thank you
Thank you 😊
Thanks sir
Thank you andi 🙏
Thank you so much andi memu America lo vunnamu vellalekapoyanu anukuntunna time lo me video chusanu.feeling so happy andi.
Thank you so much for appreciation andi 😊🙏
Chala Baga chepparu
Thank you 😊
Chala Baga explain chesaru thanku
Thank you 🙏
అరుణాచల శివ 🙏
Nenu chalasarlu vellanu rajagopuram eduru mandapam super baga
Chupincharu
Thank you andi 🙏
Thank you sir
🙏
Thank you 😊
Chala chakkaga chepparu memu ei pournami ki velthunnamu
Thank you 😊
🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻
Thank you 🙏
Chalabaga chesav tammudu
Thank you Anna 😊
TQ Anna
Thank you 😊
om namasivya
🙏
ARUNACHALAM (TIRUVANNAMALAI DISTRICT HEAD QATER'S) MEERU DAY TIME GIRIPRADAKSHANA CHESIVUNTE BAGUNDEDI & FIRST TIME GIRIPRADAKSHANA CHESEVARU 04:00 AM KI START CHEYANDI & 14 KM MAIN ROAD & FULL POLICE ZONE LO UNTUNDI.
Good video
Thank you
ప్రతి నెల గిరి ప్రదక్షిణ చేస్తాను బ్రదర్
మేరు చాల గ్రేట్ అండి, ఆహ్ అరుణాచలేశ్వరుని ఆశీస్సులు ఉన్నాయి🙏
@@ashoktraveltale thank you sir. స్వామి దయ... ఇప్పటిదాకా 25 సార్లు అయ్యింది sir.. గిరి ప్రదక్షిణ ప్రశాంతత ను కలుగ చేస్తుంది
@@narasimhuluc7322 swammy medi ya uru
@@narasimhuluc7322 true Andi. Nenu 5 times chesanu. Chala prashantanga untundi.
ఓం నమః శివాయ...మీరు అదృష్ట వంతులు
Tq
Thank you 🙏
🙏🙏🙏
Thank you 🙏
Om Arunachal Siva I'm ALSO Giri pradakshina 2am start.1.8.2023
How was the trip.
Eantha time padthadhi
Om Namasivaya 🙏
🙏
మేము ఉదయము బయలుదేరి నడుచుకుంటూ వెళ్ళినాను 12 గంటలకు దర్శనమైంది
🙏
Bujji & Chandhu arts 189 like
RAMANAMAHARSHISWAMY.GIRIPRADAKSNAM ASHIRVADHIVINCHANDI.NAKUPARKINSONSEDISIGE.THOLAGINCHANDI.FROM.MUCHKUR.
🙏
Meru anukunnadi jaragalani korukuntunanu, Om Arunachaleswarar 🕉
I am going on next Sunday
Wish you get good blessings from Arunachaleswarar Swamy 🙏
@@ashoktraveltale thank you
Welcome
Om nama shivaya
Temple lo darshanam cheskoni giri pradakshina chesara.. Leka giri pradakshina ayyaka darshanam cbeskunnara
Darsham evening 7:30 ki chesukunam, taruvata ratri 10:00 ki giri pradakshanam start chesamu.
1/6/24 mrng 7am ki start chesham malli 1 pm ki complete chesham .....
Madyanam chesaru kada, road vediga leda andi.
@@ashoktraveltale 12 nundi Baga vedi unde but trees needa chusukoni fasta ga. Vellamu
Thank you for the information 🙏.
Hi Ashok gaaru❤
Chepandi Lakshman garu.
Darshananiki enta time padtundi
2 to 4 hrs padutundi.
by Car or train vellara
By car vellamu.
Me vedio chaala bagundhi....Only linga swarupale chupincharu... Sane way lo Nandhi swarupalu kuda vuntai ani vinnam... Avi me vedio lo akkada levu... Is there any other vedio for that brother...
Thank you for the compliment 🙏, Nandhi swarupalu gurinchi telusukoni vedio pedatanu andi.
Meeru 2 am ki start chesi 1.30 am ku yela end chesarandi?
Starting time video lo mention chesara andi?
Please clarify if i am wrong.
19:03
Memu 9pm ki start chesamu and complete 2:00 am ki ayindi. Video lo kuda cheppanu timing.
Nadustu pradakshina start chesi, madhyalo opika lekapothe auto eki continue cheyochaa, autos dorukuthaya madhyalo
Konni Auto dorukutayai, kani meru opika lekapothe wait chesi giri pradakshanam cheyani, ledante taruvatha chesunte bagundi ani anipistundi, lelagaina complete cheyadi.
Bro temple lo darshaniki entha time avutundhi
1hr to 2hrs padutundi.
Where you have stayed.Please tell lodges around 500.
Within 2 km range you have lot of lodges for 500 to 1000rs, there are ashram where it provides accommodation but need to book 3 months in advance, you can book lodging online in mmt, cleartrip websites.
Thank you very much
Memu March 25th eving 7 ki pradakshna start chaysi night 12 ipoondi
🙏
Can we do giri vaalayam any day or only pournami day ?
Any day is ok, pournami day is very good but lakhs of people will be there.
Giri pradakshina only pournami roje chesthara andi.. lekpothe a roju ayina cheyochu ah..
Akkada prathi roju giri pradakshanam chestaru, pournami roju chala manchidi kakapothe lakshala lo janalu untaru. Temple website lo dates vestaru.
Tq for valuable information bro... Nenu today night veltunna
Temple closing time at 07:30 pm velandi, akkada poojari ni adigithe he will charge some amount and meru garba gudi lopalaki vellochu.
Elaga ayindi giri pradakshanam.
@@ashoktraveltale
Super brother.. 4 hour's lo complete ayindi..
Ante 7.30 tarvate na leka anthalopu kooda garba vudiloki vadultara anna
Ticket emaina teskovala@@ashoktraveltale
@@kiraakkkeerthana2020 free darshanam undi, ledanta 50 rs seegra darshnam undi.
Hi brother first arunachalam darshanam chesukovala leka giri pradakshana chesaka darshanam chesukovalaaa
Ela vellina ok andi, darshnam taruvatha giri pradakshanam ayina ok, giri pradakshanam taruvata darshanam ayina ok, evening giri pradakshanam cheste temples close ayithayi siva lingalanu chudaleru, adi chusukoni plan chesukondi.
Way majalo both room( satnam) chayavacha?
First sanam chesi appudu start cheyandi.
Temple mrng a time undi night a time varuku open lo untundi
5:00 AM to 12:30 PM and again from 3:30 PM to 9:00 PM
At what time we have to start the giripradakshina? In Poornima day please inform me sir
Hi, if you go to Arunachalam Temple website, it shows the dates and time of Girivalam.🙏
omarunachala.com/2023-girivalam-day-calendar/
Thank you very much sir
🙏
Giri pradakshina car lo vellochha peddavallu kaallanoppi unnavaru.? Dayachesi cheppandi🙏
Emi kadu andi, ah Arunachaleswaranudini talachu koni anni shiva lingamulanu chudandi. Enthavaru nadavagalaro akkadi varaku chesi taruvatha car lo vella manandi
Which Date
We went on 19th july
Konni longalu miss ayyamu paravaledaa.. Only moksha margam kubera lingam lantivi 4,5 chesamu paravaledaaa?
Girivalam chesinappudu okavela temple close aythe next day auto lo velli shiva lingalanu chudadi, kani Pradakshina chesetappudu anni temples ki velli kanisam ah shivayanu talachukovadam manchidi, tapanisari paristithi lo miss aythe malli vellandi.
Giri pradakshina chesaka దర్శనం chesukovalna
Alaga emi ledu andi, me veeluni batti, giri pradakshanam chesi darshanam chesukuvachu, ledante darshanam ayyaka giri pradakshanam chesukuvachu.
Arunachalam temple ki pournami roje vellala lekapothe eppudu ayina vellocha anna
Epudu ayna vellochu akda prathi roju giri pradkshina chestu vuntaru kani pournami ke lakhs lo vunnatru jannalu akada
Temple teleedu annaru gaa that temple is kamakshi temple
Thank you for the information 😊
6months nene mis. Last month bayaluderi 1hour mundu yatra trip vallaku sudhakam. February ki adrushtam undo ledo Arunachalam siva
Kachitanga veltaru andi, manam manasulo anukunte ah shivaya chusukuntadu.
0:33 0:36
Is there any mistake on that time.
Chandra grahanam 25,march 2024 time lo giripradakshina and darsanam ki vellavacha?
omarunachala.com/girivalam-2024/
Eh web site lo giri pradakshanam timings and dates unnayi.
@@ashoktraveltale Thank you sir
Night time kooda darshanam vuntunda
Timings 5am to 12:30pm again open at 3:30 to 08:30pm., giri pradakshanam lingas temple time morning to evening.
Anna మొదటి దర్శనం చేయించుకోవాల లేదంటే గిరి ప్రదక్షిణ చేయాలి అన్న. ఎధీ first cheyyaali anna
ఏదైనా సరే, మీరు చేరుకునే సమయం ఆధారంగా, మీరు ప్లాన్ చేసుకోవచ్చు
మేము ఉదయం 8 కి తీఫెన్ తిని బయలు దేరాం సాయంత్రం 6 అయ్యింది మేము నిదానం గా రావడం వలనే...... చెప్పులు లేకుండా వెళ్ళడం చిన్న చిన్న రాళ్ళు గుచ్చుకున్నాయి ...
పొదునపూట ఎండ ఎక్కువగా ఉంటుంది, కాళు బాగా కాలుతుంది
K@@ashoktraveltale