Lionheart 1990 Van Damme, 4k Editing Back to 80s,

Поділитися
Вставка

КОМЕНТАРІ • 6 тис.

  • @backtothe80sreels
    @backtothe80sreels  5 місяців тому +304

    LIONHEART 4K Full Film Amazon amzn.to/44V2ohD
    A woman hires a drifter as her guide through New Orleans in search of her father, who has gone missing. They discover a deadly game of cat and mouse behind his disappearance in the process.
    If you enjoyed this movie scene today please like and subscribe!

    • @BrahimKcgggghaysi
      @BrahimKcgggghaysi 4 місяці тому

      🙀😭🖤🖤🖤🖤🥱🚫🙀🚫🚫🥳🙀🙀🚫🚫🚫🙀🚫🚫🙀🙀🙀🚫🚫🙀🖤🥱🙀🚫🚫🚫🖤🖤🖤🚫🖤🥱🙀🥱🥱🇹🇳🥱🥱🥱🙀🚫😭🚫🖤🖤🖤🖤🚫🥳🩵🫒🩵🩵🩵🩵

    • @BrahimKcgggghaysi
      @BrahimKcgggghaysi 4 місяці тому

      👄🩷👄👄👄💜❤️🇱🇾🥻❤️🥻❤️🥻🥻❤️❤️🥻❤️❤️❤️🥻🥻❤️🇱🇾🥻🥻🥻🥻🥻🇻🇳🥻🥻🥻🇻🇳🥻🥻🇻🇳🥻🇻🇳🥻🥻🥻🥻🥻🇨🇮🥻🥻

    • @edwardkurbah7337
      @edwardkurbah7337 4 місяці тому +9

      Me

    • @Ninhh_
      @Ninhh_ 4 місяці тому +2

      Q1

    • @gabrielcuello8722
      @gabrielcuello8722 3 місяці тому +4

      cualquiera lo que pusiste aca abajo esa es otra pelicula no lionheart

  • @therealtinytalk1009
    @therealtinytalk1009 11 місяців тому +23

    Be nice if we could go back to the attitude of those days where everyone is not so dang sensitive! GOD BLESS ALL!

  • @InfamousB9
    @InfamousB9 2 роки тому +162

    One of the greatest fights from '90 movie era,watched this movie probably about 500 times👊👊👊

    • @mr-345countryballs.argentina
      @mr-345countryballs.argentina 6 місяців тому +6

      Whoo one of tegreatest of ❤para mis gystos👌la mejor👏Joan Cloude Van Damme👍👏👏👏

    • @elshod.lelkaran
      @elshod.lelkaran 6 місяців тому

      Seks😂1ceks1 cekSşekks vertikal holatda ekanligini veks 3:25 3:27 3:28 ​@@mr-345countryballs.argentina

    • @QwetIuuu
      @QwetIuuu 4 місяці тому +1

      مرحبا

    • @risefromyourpain
      @risefromyourpain 3 місяці тому

      Agreed. The look in Atillas eyes when he swings that head butt

    • @FERARI1LAMBO1
      @FERARI1LAMBO1 2 місяці тому

      Yyyhyhhjyjyjh😮😮😮😮😮😅😅😅😅😅😅😅😅😂😂😂

  • @maryvalentine2473
    @maryvalentine2473 2 роки тому +17

    That was a beautiful Van Damme fight, killer takes all he showed him who's better.

  • @sylvesterehimen7267
    @sylvesterehimen7267 4 місяці тому +60

    Scenes still brings tears. Van Damme is truly a legend who deserves his crown.

    • @hugoroldan-c5i
      @hugoroldan-c5i 3 місяці тому +2

      Ya es leyenda❤

    • @user-uo5um5ss1u
      @user-uo5um5ss1u Місяць тому

      wrong, r e t a r d. never made a decent movie in his life

  • @Haerinx87
    @Haerinx87 2 роки тому +65

    Bloodsport and Lionheart are Van Dammes absolute best movies!!
    I could watch them 100 times.

  • @shaktiyadav311
    @shaktiyadav311 2 роки тому +32

    Van dam se 1 baar milna chahta tha ... Amazing fighter... Blood Sports,, Dubble Impect,, all movies Awesome... Love u forever

  • @JoseCastillo-ks7uy
    @JoseCastillo-ks7uy 2 роки тому +19

    I remember being 12 years old watching all Van Damme movies

  • @hermosillo11
    @hermosillo11 Рік тому +33

    It's not about who's the biggest, it's not about being the fastest, it's about what's in the spirit and in the heart. What you get out of your inner power. To be able to adapt to the situation and change strategies if necessary. Saw this movie as a teenager.

    • @jasonlee4267
      @jasonlee4267 Рік тому +2

      its a film, this isnt possible in real life sorry to spoil it for you, having said that I like the idea of the underdog having such spirit, and these 80s and 90s flicks were so good.

    • @hermosillo11
      @hermosillo11 Рік тому +4

      @@jasonlee4267 You haven't understood anything. No one is talking about reality versus film. Think before you post, boy.

    • @ZACHANDJACKSZACHSMAFIA
      @ZACHANDJACKSZACHSMAFIA 4 місяці тому +1

      @@hermosillo11don't post idiotic things, both of you. Just enjoy the scene and get your time for embarrassment outside of the internet. Else you end up ruining your own life by worrying about the dumbest things like arguments on the internet. -Jack

    • @hermosillo11
      @hermosillo11 4 місяці тому +1

      @@ZACHANDJACKSZACHSMAFIA When the discussion took place eight months ago, it's probably just silly to play police on the internet right now. If you have a hard time reading discussion there are other places than youtube for you.,

    • @SatanaS-ed8qv
      @SatanaS-ed8qv Місяць тому

      NO!!! IS JUST A CHOREOGRAPHED SEQUENCE!!!! WHY YOU PEOPLE WATCH A DAM MOVIE AS IF IS A DOCUMENTARY????

  • @Ray-ml6iy
    @Ray-ml6iy 2 роки тому +117

    I grew up watching Van Damme. Brings back good memories. 👍🏼👍🏼

    • @gafortheloveofgamenfilm1159
      @gafortheloveofgamenfilm1159 2 роки тому +1

      Wrong BET!

    • @charlespancamo9771
      @charlespancamo9771 2 роки тому

      man is he gonna KICK HIM? I bet he kicks him! Then I bet he does a bunch of slow motion moves that anybodys mother could telegraph! After that bet he jumps up and does a slow ass kick where he spreads his legs like a gay male cheerleader! SO BADASS!

    • @YonCel-nm6ke
      @YonCel-nm6ke Рік тому +1

      Aquí bien gracias
      Quiero ir todos Quiero saber que todo bien activo y todos sabemos bien activo bien tranquilo cómo es Disculpe toda la molestia estamos ya acomodados de la mañana y somos

    • @rere5861
      @rere5861 7 місяців тому +1

      If you still watch this, you never grew up.

    • @JMGENTERPRISES
      @JMGENTERPRISES 7 місяців тому +1

      He will always be my hero! Muscles from Brussels bro!

  • @wallacegentry4085
    @wallacegentry4085 Рік тому +34

    Harrison Page/Joshua is an incredible addition to this film. He did not bet against Lion because he saw him as weak. He bet against him to save his life, because he's been there about lies and such. This is friendship!!!

  • @kenb2671
    @kenb2671 2 роки тому +27

    I love all of the Van Damme movies and have them on VHS and DVD. This one was great especially the ending.😊👍🏾

    • @walterkoziol3822
      @walterkoziol3822 2 роки тому +2

      I especially love the ending of this one. Those two guys chasing after him to take him back to their country had a change of heart and took Damme home and let him stay with them.

    • @luciochoque8512
      @luciochoque8512 2 роки тому

      .@@walterkoziol3822

    • @johair213deripuson8
      @johair213deripuson8 2 роки тому

      @@walterkoziol3822 t5t4r

    • @walterkoziol3822
      @walterkoziol3822 2 роки тому

      @@luciochoque8512 huh?

    • @walterkoziol3822
      @walterkoziol3822 2 роки тому

      @@johair213deripuson8 huh?

  • @yasamabaks4903
    @yasamabaks4903 Рік тому +9

    Van Damme Crazy Actor. From Turkey 🇹🇷

  • @straycat1674
    @straycat1674 3 роки тому +229

    As an older gentleman, and aging martial artist I look at back at films like this and I can’t help but to think, God I actually miss these.

    • @oma_elite
      @oma_elite 3 роки тому +7

      They had that inspiration factor that you just don't find much anymore. Another good one you should revisit is "Over the Top" if you like this film.

    • @straycat1674
      @straycat1674 3 роки тому +7

      @@oma_elite love that one as well

    • @erichramone7812
      @erichramone7812 3 роки тому +7

      I never realized how cheesy these were though. Bad acting, bad fake looking choreography. B level cinema all around. Plot line that is very long in the tooth, you know basically there following the original Rocky” movie. Van damm has too look in his inner most self too overcome adversity. He comes out strong, gets knocked down (many times), but somehow remembers his training or what his motivation is by again looking deep inside and then uses this to overcome his adversary. That’s every Rocky Movie, or 99% of all fighting movies ever.

    • @oma_elite
      @oma_elite 3 роки тому +6

      @@erichramone7812 You may be right but I could never bring myself to say those things. 😅

    • @erichramone7812
      @erichramone7812 3 роки тому +1

      @@oma_elite haha

  • @mexicanlord2934
    @mexicanlord2934 3 роки тому +66

    My dad use to love this movies
    RIP DAD 1962 & 1999

  • @kairatkudusov1566
    @kairatkudusov1566 2 роки тому +12

    the best actors, from the legend, we loved his films, and waited patiently

  • @arockwood30
    @arockwood30 5 місяців тому +20

    As a kid I watched all of Van Damme’s movies and was in awe of him.
    I met the man in real life.
    He is so cool and really a down-to-earth type of guy.

  • @kp8310
    @kp8310 3 роки тому +28

    Those initial punches from Van Damme to start the fight would knock out about 99.9% of men.

  • @Bartizzle739
    @Bartizzle739 3 роки тому +50

    No matter how many times i watch this film when he says “wrong bet…arhhh” gets me pumped every time lol

    • @Haerinx87
      @Haerinx87 5 місяців тому +2

      My Favourite part is "we got him, we got him" as Van Damme is punching his face!!

  • @Cobra-gl7or
    @Cobra-gl7or 3 роки тому +19

    One of my favorite childhood movies of the 1990s along with death warrant and hard target.

    • @rickyflinchum2909
      @rickyflinchum2909 3 роки тому +1

      Hard target is still one of my favorite movies to this day.

    • @kristianspencer1978
      @kristianspencer1978 3 роки тому +1

      Hard target was jcvds best film in my opinion.

  • @ailo8625
    @ailo8625 6 днів тому

    Stop Asking Who’s Still Watching!
    We Never Stop Watching To This MASTERPIECE!!-

  • @comelytravel
    @comelytravel 2 роки тому +119

    I pray who ever sees this be successful in life ❤️ ❤️

  • @alexferrier5732
    @alexferrier5732 2 роки тому +58

    Van Damme, Stallone, Arnold: The trifecta of action movie stars from the 80s-90s, this dudes were my heroes when I was a child and I still thank them for the awesome memories of badass movies, I even got into martial arts and bodybuilding because of them. Good times.

    • @vandamme1535
      @vandamme1535 2 роки тому

      👍👍👍👍👍

    • @Ayaanhuss9
      @Ayaanhuss9 2 роки тому

      @Recite-God-Heal-Me-Create-Miracles don't die as a disbelievers

    • @Ayaanhuss9
      @Ayaanhuss9 Рік тому

      @D Legionnaire who is your lord grave first question

    • @Ayaanhuss9
      @Ayaanhuss9 Рік тому

      Who is your lord grave first question

    • @Ayaanhuss9
      @Ayaanhuss9 Рік тому

      @@vandamme1535 who is your lord grave first question

  • @GetMotivated978
    @GetMotivated978 Рік тому +96

    This used to be my favourite movie when I was growing up as a kid in the 90s and 00s. I owned it on VHS tape and used to watch it like 2-3 times a week. I miss those times!

  • @diorgeridley9227
    @diorgeridley9227 Рік тому +70

    Van-Damme é simplesmente Extraordinário, vindo de geração de grandes heróis do Cinema como: Schwarzenegger, Stallone, Lundgren e outros, e home em dia nem se fazem mais filmes com essa qualidade e expressão de realismo!!!

  • @westyraviz
    @westyraviz 2 роки тому +90

    That face Attila makes immediately after the stare down with Van Damme as he turns away from Van Damme is real professional acting. The bored expression says “Why is this puny guy that I’ll easily destroy wasting my precious time by challenging me?” Then that unimpressed fleeting glance that he again gives Van Damme as he takes off his jacket expecting to see fear and timidity in Van Damme’s eyes. He nailed it! It’s not often that actors in these sorts of movies capture emotions without uttering a word. Kudos to him on the great acting!

    • @gutterbois
      @gutterbois 2 роки тому +5

      I know right he should have received an Oscar

    • @NaughtyNick5
      @NaughtyNick5 2 роки тому +2

      He was actually a boxer

    • @picallo1
      @picallo1 2 роки тому +10

      He's the brother of the guy with the beard whos chasing JCVD. Fun facts: Atilla also plays the guy from Mongolia in 'The Quest' and the guy with the beard plays the guy that Chong Li breaks his leg in 'Bloodsport' and Tong Po in KickBoxer. JCVD is very good friends with that family.

    • @Dildo_Gaggings
      @Dildo_Gaggings 2 роки тому

      Channing Tatum did the remake of this movie in 2009

    • @picallo1
      @picallo1 2 роки тому +2

      @@Dildo_Gaggings Fighting is not a remake of this.

  • @Harry_Eyeball
    @Harry_Eyeball 2 роки тому +52

    Still feels great watching Van Damme in this, 20 + years later! This movie rocked my teen years!

  • @Nick.Ackerman
    @Nick.Ackerman 2 роки тому +31

    Anxious girl
    Big hulking bad guy
    Shredded van Damme
    Black guy friend
    It has all the essentials for a great 80s movie!

    • @rere5861
      @rere5861 7 місяців тому +1

      You missed a cute baby girl.

    • @Roxana_Official
      @Roxana_Official 4 місяці тому +1

      that was when back then blacks were good and well behaved

  • @БакытбекТуманбаев-в5е
    @БакытбекТуманбаев-в5е 4 місяці тому +28

    Сколько пацанов после его фильмов пошли в спортзалы не пересчитать крепкого здоровья тебе брат ты всегда в наших сердцах

  • @louiefernandez3835
    @louiefernandez3835 3 роки тому +6

    Excellent film clip::: Van Damne!!!

  • @jakobboller9445
    @jakobboller9445 2 роки тому +14

    I just love the Van Damme fighting skills. Great fighter all time.

  • @WebgiroOficial
    @WebgiroOficial 3 роки тому +48

    Van Damme forever 👏👍

  • @jordan366
    @jordan366 10 місяців тому +9

    Estos eran PELÍCULAS!!
    Sin tantos efectos especiales. QUE ACTORES!!👏,

  • @richardfranco8861
    @richardfranco8861 2 роки тому +62

    Respect to all the Van Damme fans out there. First film i watched was Cyborg followed by Awol and now have every film he's in. Awesome martial artist and brilliant actor.

    • @xenoverse6720
      @xenoverse6720 2 роки тому

      Karaté tiger c'est le premier

    • @teamslaiyans3808
      @teamslaiyans3808 2 роки тому +1

      Hell yeah ! CYBORG is my #1 movie from JCVD 🔥🔥🔥🔥💪🏽💪🏽💪🏽💪🏽💪🏽

    • @jhongucci
      @jhongucci 2 роки тому +1

      Respeto

    • @bigc895
      @bigc895 2 роки тому

      Yes let’s just pretend coked out Van Damm never was in that disgusting trash they called Streetfighter.

    • @hannahjackson7724
      @hannahjackson7724 Рік тому

      Hi franco

  • @VainqueurRoy
    @VainqueurRoy 3 роки тому +34

    When the instant replay and the slowmo kicks in, you know that jcvd gonna win 🧐😁

  • @jimnguyen3481
    @jimnguyen3481 2 роки тому +18

    Was I the only 1 to record all these on VHS in the 90s so I can watch them all over and over 😂. Good old days.

  • @siyabongamndzebele4964
    @siyabongamndzebele4964 2 місяці тому +2

    Childhood was definitely awesome

  • @jamaalg9906
    @jamaalg9906 3 роки тому +55

    Ahh using the wilder fighting style just block everything with your face. Majestic

    • @patrickjones8255
      @patrickjones8255 3 роки тому +4

      From the school of Rocky

    • @DaveMoongazer
      @DaveMoongazer 3 роки тому +2

      Like from Kung Pow: "My face to your knee technic. I bleed. That makes me the victor!"

    • @ludwiggraupe7571
      @ludwiggraupe7571 2 роки тому

      @1 🙈😂🤣Bekommst du Watsche mit Fuß. 😅 Ja ja 😝

    • @DaveMoongazer
      @DaveMoongazer 2 роки тому

      @1 🤣🤣🤣🤣🤣

    • @victorlexander7643
      @victorlexander7643 2 роки тому

      This cracked me 🤣

  • @garyr7027
    @garyr7027 2 роки тому +9

    Legend has it, those who bet the wrong way are still broke.

  • @spiderg7601
    @spiderg7601 3 роки тому +53

    Man I remember these days..when movies were fun and exciting.. Bloodsport...Rambo...Conan..they sure don't make em like they use to

  • @Papubob
    @Papubob 9 місяців тому +1

    I grew up with Van Dame movies. My favorite actor still

  • @ryanstewart4811
    @ryanstewart4811 2 роки тому +22

    This without a doubt is John Claude Van Damme's greatest 🎬 flick, Should have been a sequel.

    • @SGTJDerek
      @SGTJDerek 2 роки тому +1

      I agree but I think it's underrated. Along with Desert Heat.

    • @Ant-speakingfacts
      @Ant-speakingfacts 2 роки тому

      @@SGTJDerek it actually is underrated but good

    • @atranfanatic
      @atranfanatic 6 місяців тому +1

      Legionairre was kind of a sequel in a way.

    • @brianticas7671
      @brianticas7671 4 місяці тому +1

      Double impact and universal soldier was good too.

  • @CosmosProvider
    @CosmosProvider 3 роки тому +39

    JC is always so over the top i can't help but love it.

    • @catsaregovernmentspies
      @catsaregovernmentspies 3 роки тому

      I think that was part of the JCVD experience, lol

    • @sultaa86
      @sultaa86 3 роки тому

      A Actor needs a Signature. Something he'll be knowen for for All time. And with JCVD it was his over dramatic yelling.

    • @timmyggztv
      @timmyggztv 3 роки тому +1

      Great movie🔥🔥🔥

  • @amandankomo9320
    @amandankomo9320 2 роки тому +8

    I miss the vibe that movies in the late 80s and early 90s had.those were the golden days in terms of music and movies.

  • @brianadams9535
    @brianadams9535 29 днів тому +1

    I was a senior in high school when I saw this still watch today

  • @Gumorisco11
    @Gumorisco11 3 роки тому +73

    Todays kids will never how thrilling these movies were

    • @darrenrenshaw7558
      @darrenrenshaw7558 3 роки тому +5

      Films I cud watch again an again, they don't even no who van damme is haha I've educated people who have film degrees 😅

    • @darrenrenshaw7558
      @darrenrenshaw7558 3 роки тому

      @Tony Ojiambo I no mate , sad init 😢, not going to lie I do play ps4 from time to time, but play games that are more realistic an got a story to them , that fortnite to cartoony for me . I bin playing since ps1 days . Jason statham awesome actor though, lock stock springs to mind 👌

  • @oldfriend327
    @oldfriend327 3 роки тому +588

    I've always loved Van Damme's movies, especially what I believe are referred to as "Direct To Home Video" movies. His movies have kept so many people company late at night at the end of a miserable work week. He really has made a great legacy of films. Very talented and disciplined martial artist and actor/producer for sure.

    • @dindjarin559
      @dindjarin559 3 роки тому +15

      I agree with most of what you said... disciplined, not so much. He is very knowledgable of various forms, and is very capable. However, to be discplined, imo, means to also be able to fully control yourself when doing fight scenes so that you don't accidently break bones or otherwise legitimately injure your co workers. JCVD has had a reputation for years of going full strength and injuring co stars and stunt doubles alike. Many reports of times where he didn't NEED to make full force contact, but he did anyway. A lot of stunt doubles who have worked on sets with him in the past, refuse to do so a second movie with him starring because of it. That is my only critique of the man. He is very generous, humble, a good hearted person, and really good at what he does at making his characters authentic and relateable.

    • @juanmora2332
      @juanmora2332 3 роки тому +6

      El me Jor de los mejores

    • @dindjarin559
      @dindjarin559 3 роки тому +8

      @Eric MillerActually, Bruce slowed his moves down for the camera during filming, as well as to limit the force of impact during those fight scenes, so as not to hurt the people he was performing with. This shows great control and discipline. I am sure even then it was difficult for the stunt actors to keep up with him. He didn't do full speed full force impacts when making movies, though.
      Chan broke his own bones doing stunts. He didn't injure others with his moves during fight scenes, though.
      Jean, on the other hand, broke other people's bones accidently several times, while doing scenes and stunts in almost every movie he was in, reportedly.
      No doubt they all know their stuff, and have put their bodies through some seriously intense & dedicated training for many years, to get where they are and to be able to withstand the things they do. JCVD definitely has earned and deserves the recognition and acknowledgment of being in the same league and class as many of the greatest martial artists and action movie stars, imo. He has some insane physical abilities and conditioning that you don't see often. no doubt.

    • @timmyggztv
      @timmyggztv 3 роки тому +5

      Great movie🔥🔥🔥

    • @yuriboyka8141
      @yuriboyka8141 3 роки тому +5

      This is so fcking bad that its just funny 😂 thx for the 20 years from this to Undisputed 🙏🏻

  • @adanballeza1147
    @adanballeza1147 3 роки тому +35

    This is one of the best jcvd fight scenes, and movies fights ever!!!👍👍👍

    • @lagb6803
      @lagb6803 3 роки тому +3

      Van da me es mi favorito de los años 70 y 80 yo soy luis y tengo 10 años

    • @sharms888
      @sharms888 3 роки тому +1

      No way, you can't beat Bloodsport !

    • @lagb6803
      @lagb6803 3 роки тому

      Gracias por todo mi gente deje los en los comentarios

  • @FernandoSousa-rd6gk
    @FernandoSousa-rd6gk Рік тому +4

    I even cheered like that the first time I watched it in the mid-2000s😅

  • @anthonyw.spears7601
    @anthonyw.spears7601 3 роки тому +11

    Never get tired of this 🎥 it is a classic 🔥🔥🔥

  • @valvenator
    @valvenator 3 роки тому +9

    Anyone else rootin' for the "bad guy" in this?
    He was actually the gentleman in the fight giving his opponent a chance to give in
    Van Damme just goes ballistic and comes after him when he's down and just don't stop to give the man a breather
    BTW I'm no fighter but seriously in real life most any one of those punches would have knocked the opponent out

    • @muchaari3019
      @muchaari3019 3 роки тому

      Hg

    • @muchaari3019
      @muchaari3019 3 роки тому

      Ik

    • @johnsuds3709
      @johnsuds3709 2 роки тому +3

      Noticed that too. Class act professional. No hate, just business. Gets the job done ruthlessly and effeciently and yet, is not needlessly excessive.

  • @brandonjordan2516
    @brandonjordan2516 3 роки тому +94

    Ah the 80s and early 90s movies.....where everybody could trade off taking 9,000 kicks and punches right to the face, ribs and legs and still stand to win a fight.

    • @antoinesubitlescoups338
      @antoinesubitlescoups338 3 роки тому

      How come current movies are any different?

    • @brandonjordan2516
      @brandonjordan2516 3 роки тому +3

      @@antoinesubitlescoups338 fight themed movies aren’t nearly as big as they used to be.

    • @oma_elite
      @oma_elite 3 роки тому

      @@brandonjordan2516 Yea evil world, too many people will just shoot ya nowadays...plus with UFC then you probably don't hear about as much other underground stuff going on anymore like in Fight club or this movie Lionheart with the street fighting. It's a shame. Some of these films are truly classics.

    • @nicolekidman4644
      @nicolekidman4644 3 роки тому +1

      Thanks for all the love and support. Seriously blown away by the love from all of you ❤Thank you all ❤️❤

    • @patbrennan6572
      @patbrennan6572 3 роки тому +2

      Must have been the water I guess. LOL.

  • @pieproducer
    @pieproducer 2 місяці тому +1

    Epic scenes love it

  • @garyarms9647
    @garyarms9647 3 роки тому +53

    Still the only fight to date that you get to see the same punch or kick 20 times in a row before you see the next one. ; )

  • @АндрейС-я5я
    @АндрейС-я5я 3 роки тому +10

    Платил рубль и смотрел фильм с гундосым переводом но сколько счастья!!!!!! Это личное мнение

    • @redoneshows_3697
      @redoneshows_3697 3 роки тому

      ua-cam.com/video/8OmI4ZbXPco/v-deo.html

    • @USA849
      @USA849 3 роки тому +1

      Не только ты получал удовольствие от просмотра етих фильмов шасс одно спецификации

    • @АндрейС-я5я
      @АндрейС-я5я 3 роки тому

      👍👍💪

    • @redoneshows_3697
      @redoneshows_3697 3 роки тому

      @@АндрейС-я5я ua-cam.com/video/720Mp2QhQkY/v-deo.html

  • @straycatsanctuary3475
    @straycatsanctuary3475 2 роки тому +5

    Absolute legend and one of my old time heroes. Love live JCVD🧿💜

  • @nelsonluis4847
    @nelsonluis4847 6 місяців тому +1

    this is the best Van Damme movie ever. this scene was epic

  • @ryanmcleod6488
    @ryanmcleod6488 3 роки тому +14

    I cried my eyes out at the end of the fight when his buddy bets against him then he still hugs him the only action movie I've ever had that level of emotional connection to the characters I think t2 that's it great movie wish I seen more like it but kind of glad I haven't makes this movie special long live jcvd

  • @brandonm8131
    @brandonm8131 3 роки тому +26

    Its amazing how so many of his films are pretty much the exact same

    • @romino29
      @romino29 3 роки тому +4

      Back then we liked it, now it looks sooo ridiculous 🙂

    • @Wolverines4ever-sl1js
      @Wolverines4ever-sl1js 3 роки тому

      Yeah they are all garbage.

    • @MohammedSoipu
      @MohammedSoipu Рік тому

      😊 0:52 you fine I am to the world in the same as you fine kafeholic and your working in this fruit of a great to see if I will get it was the India and your poem on parents to akl fruit and your
      Pisillapppismillamariamisquvaiseyourfriendisnotgoodyourfriendtoled10pophtomohamedsalakedseethatl00kedseeyouareanne0mesalakedyouaregoodfrintisn0tgp00dfrentm0hamedamgreeisn0tgoodfrientmyfacepookcanceledeletedisclocedfonishiamtoledturuplevememashallamariamisqvwiise
      0:52 😊 0:52 0:52 I don't have this okay to me in this okay I am going out for a great day and your working hours
      0:52

    • @naserabuward7194
      @naserabuward7194 Рік тому

      🎉fine

  • @bigcatmark81474
    @bigcatmark81474 3 роки тому +20

    this is a great movie. I saw this in theaters with my dad when I was younger. My aunt had come for a visit and she, my mom, my dad, and I all went. This is my FAVE JCVD movie b/c it felt the most "real" and had the most "heart."

    • @paolasarmientollerena9565
      @paolasarmientollerena9565 3 роки тому

      anacondaz

    • @paolasarmientollerena9565
      @paolasarmientollerena9565 3 роки тому

      fantasmas

    • @paolasarmientollerena9565
      @paolasarmientollerena9565 3 роки тому

      m

    • @williammunny9916
      @williammunny9916 3 роки тому

      *_John 8.31 Then Jesus said to those Jews who believed Him, “If you abide in My word, you are My disciples indeed. 32 And you shall know the truth, and the truth shall make you free.” 33 They answered Him, “We are Abraham’s descendants, and have never been in bondage to anyone. How can You say, ‘You will be made free’?” 34 Jesus answered them, “Most assuredly, I say to you, whoever commits sin is a slave of sin. 35 And a slave does not abide in the house forever, but a son abides forever. 36 Therefore if the Son makes you free, you shall be free indeed._*
      _Jesus Christ loves you. Only Jesus Christ saves. Repent and be saved. God bless you, and the grace of the Lord Jesus Christ, and the love of God, and the communion of the Holy Spirit be with you and your family._
      ---

  • @КаменьДагестана
    @КаменьДагестана Рік тому +39

    Он просто любил брата - которого потерял и хотел помочь его семье не смотря на преследование военными, и кровавый путь к успеху, настоящий герой💪

    • @rthurrabayev6971
      @rthurrabayev6971 9 місяців тому +1

      Раньше в молодости этот фильм всех сводил с ума, но когда подрос то понял что это просто фильм для детей которые любят
      Смотреть как бьют по морде и нечего не происходит 😂

  • @ratapaga5963
    @ratapaga5963 3 роки тому +32

    I like how in all of his movies they triple the hits!!

  • @petrbenes127
    @petrbenes127 3 роки тому +7

    😢❤Leon,mam na tenhle film krasne vzpominky i na tu dobu kdy to byla novinka🙂!

  • @calikat1751
    @calikat1751 3 роки тому +10

    I wish this legacy will remain forever!!

  • @ZitaDavid-z7l
    @ZitaDavid-z7l 9 місяців тому

    Respect pentru munca lui Vandame depusă este o legendă!

  • @Kai-yx1eb
    @Kai-yx1eb 3 роки тому +93

    this movie was such a great memory from my childhood. no one will ever surpass Van Damme as the best action star.

    • @sureshbabu3498
      @sureshbabu3498 3 роки тому

      👍

    • @undefeatableyt7
      @undefeatableyt7 3 роки тому +10

      Ever heard about Arnold Schwarzenegger or Sylvester Stallone

    • @williammunny9916
      @williammunny9916 3 роки тому +7

      *_John 8.31 Then Jesus said to those Jews who believed Him, “If you abide in My word, you are My disciples indeed. 32 And you shall know the truth, and the truth shall make you free.” 33 They answered Him, “We are Abraham’s descendants, and have never been in bondage to anyone. How can You say, ‘You will be made free’?” 34 Jesus answered them, “Most assuredly, I say to you, whoever commits sin is a slave of sin. 35 And a slave does not abide in the house forever, but a son abides forever. 36 Therefore if the Son makes you free, you shall be free indeed._*
      _Jesus Christ loves you. Only Jesus Christ saves. Repent and be saved. God bless you, and the grace of the Lord Jesus Christ, and the love of God, and the communion of the Holy Spirit be with you and your family._
      ---

    • @alanbanaga4691
      @alanbanaga4691 2 роки тому

      @@undefeatableyt7 uu777h

    • @undefeatableyt7
      @undefeatableyt7 2 роки тому

      @@alanbanaga4691 wdym?

  • @McCorduRoy1972
    @McCorduRoy1972 3 роки тому +28

    Love the the acting from Attilla and how he remembered his line Youhhhhhhh!!!!

    • @jaz.lamber2378
      @jaz.lamber2378 3 роки тому

      ua-cam.com/video/qJ2cfVsB50A/v-deo.html

  • @viewmaster617
    @viewmaster617 2 роки тому +64

    One of the most emotional fight scenes I ever watched

  • @Dav1d_Angel
    @Dav1d_Angel 3 місяці тому

    I miss that kind of movies👍

  • @ilagandiafox5439
    @ilagandiafox5439 3 роки тому +6

    I really love vandamme. Great actor n martial arts.

  • @maradona4569
    @maradona4569 3 роки тому +13

    Ah le bon vieux temps ça me rappelle ma jeunesse Jean-Claude Vandamme merci mon frérot

  • @brandonmanuel4690
    @brandonmanuel4690 2 роки тому +7

    Damn I love this VanDam this one hold a special place in my heart ❤

  • @antoanetamarinova5322
    @antoanetamarinova5322 5 місяців тому +6

    Wann Dam ist eine von SCHÖNSTES Männern in die Welt! Viel Dank!

  • @squelch079
    @squelch079 2 роки тому +4

    When Van dammes face is shaking you know the opponent is up for an ice cold can of ass whooping😄😄

  • @aleksey134rus7
    @aleksey134rus7 3 роки тому +19

    Jean-Claude Van Damme, The Best! ✊🏻✊🏻✊🏻👊🏻👊🏻👊🏻

  • @cowboysvstheworld3879
    @cowboysvstheworld3879 3 роки тому +31

    I like how his buddy remains on the floor on his hands and knees threw out the entire fight. Like I'll be right here when ya get back bro 😆

  • @Mikey-no9eu
    @Mikey-no9eu 3 місяці тому

    Vero , avevo anche io il poster di Van dammone in camera , i combattimenti erano belli in questi film/soundtrack/location top e lui una leggenda 90s. Grazie JVC ❤

  • @dannyellaboatboat
    @dannyellaboatboat 3 роки тому +31

    Love this scene! Bro, you know you got your work cut out for you when your opponent casually rolls his shoulders as if he’s still warming up, after tanking your initial flurry of punches lol

  • @josephcarl4167
    @josephcarl4167 3 роки тому +130

    When you realize that Van Damme used the same actors for almost 90 percent of his villains in his movies... I always appreciated that

    • @sharms888
      @sharms888 3 роки тому +1

      what ! like who ?

    • @danmccauley80
      @danmccauley80 3 роки тому +12

      @@sharms888 well the bald foreign legion guy is tong po and atilla is the end guy from the quest

    • @nickb5891
      @nickb5891 3 роки тому +5

      @@danmccauley80 the Mongolian fighter in The Quest right?

    • @danmccauley80
      @danmccauley80 3 роки тому +3

      @@nickb5891 yeah that's the one

    • @taofeng718
      @taofeng718 3 роки тому +5

      Let’s not forget about Bolo!

  • @supremozx1z110
    @supremozx1z110 3 роки тому +17

    Thank you for sharing.this was my uncle favorite scene. RIP Agusto F..

  • @michaelandia3171
    @michaelandia3171 Місяць тому

    Me always and forever!!! One of the best 80/90s actions ogs

  • @kpham8789
    @kpham8789 3 роки тому +39

    Watching this guy's movies is like watching professional wrestling. He got his ass beat throughout the fight. And all of a sudden out of nowhere he got super human strength, came back and win the fight.

  • @jasonwilson290
    @jasonwilson290 3 роки тому +30

    Movie that bring back so much good memories from a poor child hood in Jamaica.

  • @vikramgupta1366
    @vikramgupta1366 3 роки тому +6

    I have seen this many times. Best scene.

  • @garywagstaff8104
    @garywagstaff8104 3 місяці тому

    Love these kind of van dam films they was the best 👌

  • @gdjaybee742
    @gdjaybee742 3 роки тому +40

    The 10 year old me is like.. Best JVD movie ever.. The 40 year me is like... YEAH lets stand there find out who can take the most beating. NO DODGING! JUST TAKE EVERY PUNCH AND KICK.

    • @oma_elite
      @oma_elite 3 роки тому +2

      Atilla was always toying his opponents, letting them get hits in earlier in the movie too. I'd like to think he underestimated the power Jean claude was coming with, with those fast kicks at the end once he got mad and made his last stand....but yea I do see what you mean. Still love this fight. These movies back then where inspirational.

    • @jameschesterton
      @jameschesterton 3 роки тому +1

      That's a good point actually haha, kinda funny though.

    • @moshuhnanren5845
      @moshuhnanren5845 3 роки тому +4

      Hey man nothing wrong with that lol they just did it cause its manly

    • @русАаарус
      @русАаарус 3 роки тому

      @@oma_elite аитыс

    • @romino29
      @romino29 3 роки тому

      Maybe it was their strategy, to wear down their opponent. Couldn't you see that those direct punches to the face did them almost no harm ? 😅

  • @user-wz3tg8il1j
    @user-wz3tg8il1j 2 роки тому +8

    I had a fight exactly like that once, it was brutal. Exactly, except without all the kicking and punching, but otherwise exactly.

  • @احمدأبوالهول-ص2س
    @احمدأبوالهول-ص2س 3 роки тому +43

    I love Damme's strong kicks.
    They are the key factor enabling him to beat his opponents!

    • @oma_elite
      @oma_elite 3 роки тому +2

      Yep. It is already known that legs can produce more power than a punch, but it's harder to accurately kick somone in the head than to punch depending....but if you can get those legs up like that and fast and with accuracy then it could definitely be a advantage.

    • @giuseppebattagliese6424
      @giuseppebattagliese6424 3 роки тому

      ​@@oma_elite And this is the great martial arts fight (but I recommend the whole movie): ua-cam.com/video/0vmWSDGdNbk/v-deo.html

    • @МухаммадСаймродов
      @МухаммадСаймродов 3 роки тому

      Што

    • @MrPAULONEAL
      @MrPAULONEAL 3 роки тому

      And that he's the hero...

  • @brianticas7671
    @brianticas7671 4 місяці тому +10

    90s actors were special man. Van damme, Sylvester Stallone, Arnold Schwarzenegger, bruce willis, and dolph Lundgren.

    • @garyluck4929
      @garyluck4929 4 місяці тому +2

      Forgot about Chuck Norris 😊

  • @guardiandstroyer9120
    @guardiandstroyer9120 3 роки тому +24

    Fun fact, the actor who plays Atilla(Abdel Qissi), is Tong Po(Michel Qissi) his brother.

    • @jayrod0603
      @jayrod0603 3 роки тому +4

      Oh shit cool

    • @Christopher-o_O
      @Christopher-o_O 3 роки тому +6

      @@jayrod0603 Yeah, Abdel plays the Mongol in Van Damme's "The Quest" as well. Van Damme is tight with that family, so they kept starring in his films. Michel Qissi was in Bloodsport as well for instance, most people didn't realise that... he plays the Brazilian dude, Paredes.

    • @danhiser4891
      @danhiser4891 3 роки тому

      And he plays the big mongal in the movie quest

    • @guardiandstroyer9120
      @guardiandstroyer9120 3 роки тому +1

      @@Christopher-o_O Actually that is very well known. Since Michel was his sparring partner for years. So like you said he kept using Abdel and Michel in his movies, but Atilla and Tong-Po were the biggest roles they could get. He also loved Bolo for Bloodsport and Double Impact, he has a great relationship with him as well.

    • @aliakauser4279
      @aliakauser4279 2 роки тому +1

      Yes knew this since i was young very close all these guys ❤️

  • @markusmjoadorador1697
    @markusmjoadorador1697 2 роки тому +7

    THE BEST VANDAME

  • @Macoers123
    @Macoers123 2 роки тому +4

    " 50% off everything that comes in! Wrong Bet!!! " 🤯😡 👏👏👏 Best scene!

  • @eugeniedepagie5382
    @eugeniedepagie5382 7 місяців тому

    Hij is geweldig onze Belgische held ! Respect

  • @TopFlightSecurity415
    @TopFlightSecurity415 3 роки тому +29

    his best performance ...this last fight was so moving to me when i was younger

  • @alexanderchnsk
    @alexanderchnsk 3 роки тому +33

    Cuando se peleaba por cosas por las que valía la pena pelear. Ahora las peleas que uno ve en las películas son por pura trivialidad.

    • @redoneshows_3697
      @redoneshows_3697 3 роки тому

      ua-cam.com/video/8OmI4ZbXPco/v-deo.html

    • @pazjusticaliberdade1166
      @pazjusticaliberdade1166 3 роки тому +1

      S

    • @williammunny9916
      @williammunny9916 3 роки тому

      *_John 8.31 Then Jesus said to those Jews who believed Him, “If you abide in My word, you are My disciples indeed. 32 And you shall know the truth, and the truth shall make you free.” 33 They answered Him, “We are Abraham’s descendants, and have never been in bondage to anyone. How can You say, ‘You will be made free’?” 34 Jesus answered them, “Most assuredly, I say to you, whoever commits sin is a slave of sin. 35 And a slave does not abide in the house forever, but a son abides forever. 36 Therefore if the Son makes you free, you shall be free indeed._*
      _Jesus Christ loves you. Only Jesus Christ saves. Repent and be saved. God bless you, and the grace of the Lord Jesus Christ, and the love of God, and the communion of the Holy Spirit be with you and your family._
      ---

  • @tommylundin5115
    @tommylundin5115 Рік тому +36

    Loved his movies and still does. Great fighting choreography

  • @BiramSenge
    @BiramSenge Рік тому

    ❤❤❤❤❤😢😢😢thank you ❤❤❤

  • @leadspot
    @leadspot 2 роки тому +17

    this to me still is the best van damme movie, the class comment, the family theme, the survival theme and the weight of the fights, this movie has a lot of heart not just an action pack movie, I really love this movie

    • @MuhammadIsMuslim
      @MuhammadIsMuslim 2 роки тому +1

      er sir, excuse me but... There was Kickboxer too

    • @megavolt67
      @megavolt67 2 роки тому

      This movie has a lot of heart for sure. It's my second favorite of his after Bloodsport.

  • @soumenmitra1181
    @soumenmitra1181 2 роки тому +12

    THERE ARE MANY ACTION HEROES BUT ONLY VANDAMME'S ACTION CONNECTS...IT TOUCHES HEART WITH EMOTION.

  • @CBPM_
    @CBPM_ 2 роки тому +51

    "That dude's gonna kill yo ass! Don't you know that??" A line so good he got to say it three times in a row.

    • @mikeoxbig1978
      @mikeoxbig1978 2 роки тому +2

      That dude's gonna kill yo ass! Don't you know that!?

    • @mikeoxbig1978
      @mikeoxbig1978 2 роки тому +1

      That dude's gonna kill yo ass! Don't you know that!?

    • @gaiusjuliusceasar5180
      @gaiusjuliusceasar5180 2 роки тому +2

      Me too: That Dude is Gonna Kill Ur Ass! Lion Heaaaartttt!

    • @stephenmaharaj5230
      @stephenmaharaj5230 2 роки тому +4

      A line that brings back fond memories of Lincoln Osiris as played by the great Kirk Lazurus.

    • @juanarojas7174
      @juanarojas7174 2 роки тому

      Sin duda la mejor película bravo