🔥 Back to the 80s - if you’re not subscribed, you’re missing out on the greatest era of cinema! From Van Damme’s most iconic fight scenes to the best nostalgic action movies, it’s all here! 4 million people are already on the right track-will you sit out or join this legendary family? Now or never! Relive the nostalgia, see the legendary stars again, and experience all the unforgettable moments of the 80s. If you’re a Van Damme fan or a cinema lover… this channel is for YOU!
Harrison Page/Joshua is an incredible addition to this film. He did not bet against Lion because he saw him as weak. He bet against him to save his life, because he's been there about lies and such. This is friendship!!!
man is he gonna KICK HIM? I bet he kicks him! Then I bet he does a bunch of slow motion moves that anybodys mother could telegraph! After that bet he jumps up and does a slow ass kick where he spreads his legs like a gay male cheerleader! SO BADASS!
Aquí bien gracias Quiero ir todos Quiero saber que todo bien activo y todos sabemos bien activo bien tranquilo cómo es Disculpe toda la molestia estamos ya acomodados de la mañana y somos
I never realized how cheesy these were though. Bad acting, bad fake looking choreography. B level cinema all around. Plot line that is very long in the tooth, you know basically there following the original Rocky” movie. Van damm has too look in his inner most self too overcome adversity. He comes out strong, gets knocked down (many times), but somehow remembers his training or what his motivation is by again looking deep inside and then uses this to overcome his adversary. That’s every Rocky Movie, or 99% of all fighting movies ever.
That face Attila makes immediately after the stare down with Van Damme as he turns away from Van Damme is real professional acting. The bored expression says “Why is this puny guy that I’ll easily destroy wasting my precious time by challenging me?” Then that unimpressed fleeting glance that he again gives Van Damme as he takes off his jacket expecting to see fear and timidity in Van Damme’s eyes. He nailed it! It’s not often that actors in these sorts of movies capture emotions without uttering a word. Kudos to him on the great acting!
He's the brother of the guy with the beard whos chasing JCVD. Fun facts: Atilla also plays the guy from Mongolia in 'The Quest' and the guy with the beard plays the guy that Chong Li breaks his leg in 'Bloodsport' and Tong Po in KickBoxer. JCVD is very good friends with that family.
It's not about who's the biggest, it's not about being the fastest, it's about what's in the spirit and in the heart. What you get out of your inner power. To be able to adapt to the situation and change strategies if necessary. Saw this movie as a teenager.
its a film, this isnt possible in real life sorry to spoil it for you, having said that I like the idea of the underdog having such spirit, and these 80s and 90s flicks were so good.
@@hermosillo11don't post idiotic things, both of you. Just enjoy the scene and get your time for embarrassment outside of the internet. Else you end up ruining your own life by worrying about the dumbest things like arguments on the internet. -Jack
@@ZACHANDJACKSZACHSMAFIA When the discussion took place eight months ago, it's probably just silly to play police on the internet right now. If you have a hard time reading discussion there are other places than youtube for you.,
This used to be my favourite movie when I was growing up as a kid in the 90s and 00s. I owned it on VHS tape and used to watch it like 2-3 times a week. I miss those times!
@Tony Ojiambo I no mate , sad init 😢, not going to lie I do play ps4 from time to time, but play games that are more realistic an got a story to them , that fortnite to cartoony for me . I bin playing since ps1 days . Jason statham awesome actor though, lock stock springs to mind 👌
I especially love the ending of this one. Those two guys chasing after him to take him back to their country had a change of heart and took Damme home and let him stay with them.
Ah the 80s and early 90s movies.....where everybody could trade off taking 9,000 kicks and punches right to the face, ribs and legs and still stand to win a fight.
@@brandonjordan2516 Yea evil world, too many people will just shoot ya nowadays...plus with UFC then you probably don't hear about as much other underground stuff going on anymore like in Fight club or this movie Lionheart with the street fighting. It's a shame. Some of these films are truly classics.
Respect to all the Van Damme fans out there. First film i watched was Cyborg followed by Awol and now have every film he's in. Awesome martial artist and brilliant actor.
Van-Damme é simplesmente Extraordinário, vindo de geração de grandes heróis do Cinema como: Schwarzenegger, Stallone, Lundgren e outros, e home em dia nem se fazem mais filmes com essa qualidade e expressão de realismo!!!
Anyone else rootin' for the "bad guy" in this? He was actually the gentleman in the fight giving his opponent a chance to give in Van Damme just goes ballistic and comes after him when he's down and just don't stop to give the man a breather BTW I'm no fighter but seriously in real life most any one of those punches would have knocked the opponent out
Vero , avevo anche io il poster di Van dammone in camera , i combattimenti erano belli in questi film/soundtrack/location top e lui una leggenda 90s. Grazie JVC ❤
Van Damme, Stallone, Arnold: The trifecta of action movie stars from the 80s-90s, this dudes were my heroes when I was a child and I still thank them for the awesome memories of badass movies, I even got into martial arts and bodybuilding because of them. Good times.
I've always loved Van Damme's movies, especially what I believe are referred to as "Direct To Home Video" movies. His movies have kept so many people company late at night at the end of a miserable work week. He really has made a great legacy of films. Very talented and disciplined martial artist and actor/producer for sure.
I agree with most of what you said... disciplined, not so much. He is very knowledgable of various forms, and is very capable. However, to be discplined, imo, means to also be able to fully control yourself when doing fight scenes so that you don't accidently break bones or otherwise legitimately injure your co workers. JCVD has had a reputation for years of going full strength and injuring co stars and stunt doubles alike. Many reports of times where he didn't NEED to make full force contact, but he did anyway. A lot of stunt doubles who have worked on sets with him in the past, refuse to do so a second movie with him starring because of it. That is my only critique of the man. He is very generous, humble, a good hearted person, and really good at what he does at making his characters authentic and relateable.
@Eric MillerActually, Bruce slowed his moves down for the camera during filming, as well as to limit the force of impact during those fight scenes, so as not to hurt the people he was performing with. This shows great control and discipline. I am sure even then it was difficult for the stunt actors to keep up with him. He didn't do full speed full force impacts when making movies, though. Chan broke his own bones doing stunts. He didn't injure others with his moves during fight scenes, though. Jean, on the other hand, broke other people's bones accidently several times, while doing scenes and stunts in almost every movie he was in, reportedly. No doubt they all know their stuff, and have put their bodies through some seriously intense & dedicated training for many years, to get where they are and to be able to withstand the things they do. JCVD definitely has earned and deserves the recognition and acknowledgment of being in the same league and class as many of the greatest martial artists and action movie stars, imo. He has some insane physical abilities and conditioning that you don't see often. no doubt.
Watching this guy's movies is like watching professional wrestling. He got his ass beat throughout the fight. And all of a sudden out of nowhere he got super human strength, came back and win the fight.
@@jayrod0603 Yeah, Abdel plays the Mongol in Van Damme's "The Quest" as well. Van Damme is tight with that family, so they kept starring in his films. Michel Qissi was in Bloodsport as well for instance, most people didn't realise that... he plays the Brazilian dude, Paredes.
@@Christopher-o_O Actually that is very well known. Since Michel was his sparring partner for years. So like you said he kept using Abdel and Michel in his movies, but Atilla and Tong-Po were the biggest roles they could get. He also loved Bolo for Bloodsport and Double Impact, he has a great relationship with him as well.
I cried my eyes out at the end of the fight when his buddy bets against him then he still hugs him the only action movie I've ever had that level of emotional connection to the characters I think t2 that's it great movie wish I seen more like it but kind of glad I haven't makes this movie special long live jcvd
😊 0:52 you fine I am to the world in the same as you fine kafeholic and your working in this fruit of a great to see if I will get it was the India and your poem on parents to akl fruit and your Pisillapppismillamariamisquvaiseyourfriendisnotgoodyourfriendtoled10pophtomohamedsalakedseethatl00kedseeyouareanne0mesalakedyouaregoodfrintisn0tgp00dfrentm0hamedamgreeisn0tgoodfrientmyfacepookcanceledeletedisclocedfonishiamtoledturuplevememashallamariamisqvwiise 0:52 😊 0:52 0:52 I don't have this okay to me in this okay I am going out for a great day and your working hours 0:52
Love this scene! Bro, you know you got your work cut out for you when your opponent casually rolls his shoulders as if he’s still warming up, after tanking your initial flurry of punches lol
The 10 year old me is like.. Best JVD movie ever.. The 40 year me is like... YEAH lets stand there find out who can take the most beating. NO DODGING! JUST TAKE EVERY PUNCH AND KICK.
Atilla was always toying his opponents, letting them get hits in earlier in the movie too. I'd like to think he underestimated the power Jean claude was coming with, with those fast kicks at the end once he got mad and made his last stand....but yea I do see what you mean. Still love this fight. These movies back then where inspirational.
this is a great movie. I saw this in theaters with my dad when I was younger. My aunt had come for a visit and she, my mom, my dad, and I all went. This is my FAVE JCVD movie b/c it felt the most "real" and had the most "heart."
*_John 8.31 Then Jesus said to those Jews who believed Him, “If you abide in My word, you are My disciples indeed. 32 And you shall know the truth, and the truth shall make you free.” 33 They answered Him, “We are Abraham’s descendants, and have never been in bondage to anyone. How can You say, ‘You will be made free’?” 34 Jesus answered them, “Most assuredly, I say to you, whoever commits sin is a slave of sin. 35 And a slave does not abide in the house forever, but a son abides forever. 36 Therefore if the Son makes you free, you shall be free indeed._* _Jesus Christ loves you. Only Jesus Christ saves. Repent and be saved. God bless you, and the grace of the Lord Jesus Christ, and the love of God, and the communion of the Holy Spirit be with you and your family._ ---
🔥 Back to the 80s - if you’re not subscribed, you’re missing out on the greatest era of cinema! From Van Damme’s most iconic fight scenes to the best nostalgic action movies, it’s all here! 4 million people are already on the right track-will you sit out or join this legendary family?
Now or never! Relive the nostalgia, see the legendary stars again, and experience all the unforgettable moments of the 80s. If you’re a Van Damme fan or a cinema lover… this channel is for YOU!
🙀😭🖤🖤🖤🖤🥱🚫🙀🚫🚫🥳🙀🙀🚫🚫🚫🙀🚫🚫🙀🙀🙀🚫🚫🙀🖤🥱🙀🚫🚫🚫🖤🖤🖤🚫🖤🥱🙀🥱🥱🇹🇳🥱🥱🥱🙀🚫😭🚫🖤🖤🖤🖤🚫🥳🩵🫒🩵🩵🩵🩵
👄🩷👄👄👄💜❤️🇱🇾🥻❤️🥻❤️🥻🥻❤️❤️🥻❤️❤️❤️🥻🥻❤️🇱🇾🥻🥻🥻🥻🥻🇻🇳🥻🥻🥻🇻🇳🥻🥻🇻🇳🥻🇻🇳🥻🥻🥻🥻🥻🇨🇮🥻🥻
Me
Q1
cualquiera lo que pusiste aca abajo esa es otra pelicula no lionheart
Scenes still brings tears. Van Damme is truly a legend who deserves his crown.
Ya es leyenda❤
wrong, r e t a r d. never made a decent movie in his life
@@user-uo5um5ss1u This is your life, watching clips and making comments about things you dont like. Impressive, what have you done lately.
One of the greatest fights from '90 movie era,watched this movie probably about 500 times👊👊👊
Whoo one of tegreatest of ❤para mis gystos👌la mejor👏Joan Cloude Van Damme👍👏👏👏
Seks😂1ceks1 cekSşekks vertikal holatda ekanligini veks 3:25 3:27 3:28 @@mr-345countryballs.argentina
مرحبا
Agreed. The look in Atillas eyes when he swings that head butt
Yyyhyhhjyjyjh😮😮😮😮😮😅😅😅😅😅😅😅😅😂😂😂
I pray who ever sees this be successful in life ❤️ ❤️
Amen
Ameen Ameen Ameen
Amen
Amen
Be nice if we could go back to the attitude of those days where everyone is not so dang sensitive! GOD BLESS ALL!
Bl
Bloodsport and Lionheart are Van Dammes absolute best movies!!
I could watch them 100 times.
You forgot Kickboxer....best training montage of all time! Well, along with Bloodsport.
Universal soldier was good too
I agree!
Dododo
My best cyborg
That was a beautiful Van Damme fight, killer takes all he showed him who's better.
4
Está película no me cansaré de verla nunca
Van dam se 1 baar milna chahta tha ... Amazing fighter... Blood Sports,, Dubble Impect,, all movies Awesome... Love u forever
Фуфло....
Van Damme Crazy Actor. From Turkey 🇹🇷
I remember being 12 years old watching all Van Damme movies
the best actors, from the legend, we loved his films, and waited patiently
Van Damme forever 👏👍
No mercy
Very nice
Estos eran PELÍCULAS!!
Sin tantos efectos especiales. QUE ACTORES!!👏,
Those initial punches from Van Damme to start the fight would knock out about 99.9% of men.
Wrong!!! 99.6%
Hola
Or as one WBC commentator said "A hit from any of these guys would send 99,9% of men to the shadow realm" 😂
My dad use to love this movies
RIP DAD 1962 & 1999
You had two dads? Lol
Can you believe 😅
@@JonathanHebrews dude show some respect, are you that stupid?
Anxious girl
Big hulking bad guy
Shredded van Damme
Black guy friend
It has all the essentials for a great 80s movie!
You missed a cute baby girl.
that was when back then blacks were good and well behaved
As a kid I watched all of Van Damme’s movies and was in awe of him.
I met the man in real life.
He is so cool and really a down-to-earth type of guy.
Harrison Page/Joshua is an incredible addition to this film. He did not bet against Lion because he saw him as weak. He bet against him to save his life, because he's been there about lies and such. This is friendship!!!
I grew up watching Van Damme. Brings back good memories. 👍🏼👍🏼
Wrong BET!
man is he gonna KICK HIM? I bet he kicks him! Then I bet he does a bunch of slow motion moves that anybodys mother could telegraph! After that bet he jumps up and does a slow ass kick where he spreads his legs like a gay male cheerleader! SO BADASS!
Aquí bien gracias
Quiero ir todos Quiero saber que todo bien activo y todos sabemos bien activo bien tranquilo cómo es Disculpe toda la molestia estamos ya acomodados de la mañana y somos
If you still watch this, you never grew up.
He will always be my hero! Muscles from Brussels bro!
JC is always so over the top i can't help but love it.
I think that was part of the JCVD experience, lol
A Actor needs a Signature. Something he'll be knowen for for All time. And with JCVD it was his over dramatic yelling.
Great movie🔥🔥🔥
This is just frigging awesome to watch this again in HD and I'm 45 watched it at 14.
As an older gentleman, and aging martial artist I look at back at films like this and I can’t help but to think, God I actually miss these.
They had that inspiration factor that you just don't find much anymore. Another good one you should revisit is "Over the Top" if you like this film.
@@oma_elite love that one as well
I never realized how cheesy these were though. Bad acting, bad fake looking choreography. B level cinema all around. Plot line that is very long in the tooth, you know basically there following the original Rocky” movie. Van damm has too look in his inner most self too overcome adversity. He comes out strong, gets knocked down (many times), but somehow remembers his training or what his motivation is by again looking deep inside and then uses this to overcome his adversary. That’s every Rocky Movie, or 99% of all fighting movies ever.
@@erichramone7812 You may be right but I could never bring myself to say those things. 😅
@@oma_elite haha
I just love the Van Damme fighting skills. Great fighter all time.
No matter how many times i watch this film when he says “wrong bet…arhhh” gets me pumped every time lol
My Favourite part is "we got him, we got him" as Van Damme is punching his face!!
@@Haerinx87 Don't mind admitting being a bit weepy at that point.
Stop Asking Who’s Still Watching!
We Never Stop Watching To This MASTERPIECE!!-
Платил рубль и смотрел фильм с гундосым переводом но сколько счастья!!!!!! Это личное мнение
ua-cam.com/video/8OmI4ZbXPco/v-deo.html
Не только ты получал удовольствие от просмотра етих фильмов шасс одно спецификации
👍👍💪
@@АндрейС-я5я ua-cam.com/video/720Mp2QhQkY/v-deo.html
That face Attila makes immediately after the stare down with Van Damme as he turns away from Van Damme is real professional acting. The bored expression says “Why is this puny guy that I’ll easily destroy wasting my precious time by challenging me?” Then that unimpressed fleeting glance that he again gives Van Damme as he takes off his jacket expecting to see fear and timidity in Van Damme’s eyes. He nailed it! It’s not often that actors in these sorts of movies capture emotions without uttering a word. Kudos to him on the great acting!
I know right he should have received an Oscar
He was actually a boxer
He's the brother of the guy with the beard whos chasing JCVD. Fun facts: Atilla also plays the guy from Mongolia in 'The Quest' and the guy with the beard plays the guy that Chong Li breaks his leg in 'Bloodsport' and Tong Po in KickBoxer. JCVD is very good friends with that family.
Channing Tatum did the remake of this movie in 2009
@@Dildo_Gaggings Fighting is not a remake of this.
Jean-Claude Van Damme, The Best! ✊🏻✊🏻✊🏻👊🏻👊🏻👊🏻
Hello
@@samsonlawal8387 Hello, my from Russia
It's not about who's the biggest, it's not about being the fastest, it's about what's in the spirit and in the heart. What you get out of your inner power. To be able to adapt to the situation and change strategies if necessary. Saw this movie as a teenager.
its a film, this isnt possible in real life sorry to spoil it for you, having said that I like the idea of the underdog having such spirit, and these 80s and 90s flicks were so good.
@@jasonlee4267 You haven't understood anything. No one is talking about reality versus film. Think before you post, boy.
@@hermosillo11don't post idiotic things, both of you. Just enjoy the scene and get your time for embarrassment outside of the internet. Else you end up ruining your own life by worrying about the dumbest things like arguments on the internet. -Jack
@@ZACHANDJACKSZACHSMAFIA When the discussion took place eight months ago, it's probably just silly to play police on the internet right now. If you have a hard time reading discussion there are other places than youtube for you.,
NO!!! IS JUST A CHOREOGRAPHED SEQUENCE!!!! WHY YOU PEOPLE WATCH A DAM MOVIE AS IF IS A DOCUMENTARY????
One of my favorite childhood movies of the 1990s along with death warrant and hard target.
Hard target is still one of my favorite movies to this day.
Hard target was jcvds best film in my opinion.
Nowhere to Run is awesome also!
When Van dammes face is shaking you know the opponent is up for an ice cold can of ass whooping😄😄
Was I the only 1 to record all these on VHS in the 90s so I can watch them all over and over 😂. Good old days.
Nope! U wasn't!
Yeah sucked that we were recording the edited versions
Akona
Van dam I'm always supporting u❤❤
This used to be my favourite movie when I was growing up as a kid in the 90s and 00s. I owned it on VHS tape and used to watch it like 2-3 times a week. I miss those times!
Ftyuí
Same man never beat these sorts classics 👌
大和ハウス工業
シーレックス
テイケイ西日本
裏社会
広島県警察
公安警察
検察庁
草津病院
This and Bloodsport all day!
Bende defalarca izledim dostum
Todays kids will never how thrilling these movies were
Films I cud watch again an again, they don't even no who van damme is haha I've educated people who have film degrees 😅
@Tony Ojiambo I no mate , sad init 😢, not going to lie I do play ps4 from time to time, but play games that are more realistic an got a story to them , that fortnite to cartoony for me . I bin playing since ps1 days . Jason statham awesome actor though, lock stock springs to mind 👌
Never get tired of this 🎥 it is a classic 🔥🔥🔥
When the instant replay and the slowmo kicks in, you know that jcvd gonna win 🧐😁
ua-cam.com/video/8OmI4ZbXPco/v-deo.html
Que Bom gostei
Ehhhhhhhhhhhhh!!!
Legend has it, those who bet the wrong way are still broke.
I love all of the Van Damme movies and have them on VHS and DVD. This one was great especially the ending.😊👍🏾
I especially love the ending of this one. Those two guys chasing after him to take him back to their country had a change of heart and took Damme home and let him stay with them.
.@@walterkoziol3822
@@walterkoziol3822 t5t4r
@@luciochoque8512 huh?
@@johair213deripuson8 huh?
Wann Dam ist eine von SCHÖNSTES Männern in die Welt! Viel Dank!
Absolute legend and one of my old time heroes. Love live JCVD🧿💜
Ah the 80s and early 90s movies.....where everybody could trade off taking 9,000 kicks and punches right to the face, ribs and legs and still stand to win a fight.
How come current movies are any different?
@@antoinesubitlescoups338 fight themed movies aren’t nearly as big as they used to be.
@@brandonjordan2516 Yea evil world, too many people will just shoot ya nowadays...plus with UFC then you probably don't hear about as much other underground stuff going on anymore like in Fight club or this movie Lionheart with the street fighting. It's a shame. Some of these films are truly classics.
Thanks for all the love and support. Seriously blown away by the love from all of you ❤Thank you all ❤️❤
Must have been the water I guess. LOL.
Respect to all the Van Damme fans out there. First film i watched was Cyborg followed by Awol and now have every film he's in. Awesome martial artist and brilliant actor.
Karaté tiger c'est le premier
Hell yeah ! CYBORG is my #1 movie from JCVD 🔥🔥🔥🔥💪🏽💪🏽💪🏽💪🏽💪🏽
Respeto
Yes let’s just pretend coked out Van Damm never was in that disgusting trash they called Streetfighter.
Hi franco
СиЛьныЙ ФиЛьМ 👌👍👍👍
Van-Damme é simplesmente Extraordinário, vindo de geração de grandes heróis do Cinema como: Schwarzenegger, Stallone, Lundgren e outros, e home em dia nem se fazem mais filmes com essa qualidade e expressão de realismo!!!
Ako
na
Akona
Akona
Bandan
Ahh using the wilder fighting style just block everything with your face. Majestic
From the school of Rocky
Like from Kung Pow: "My face to your knee technic. I bleed. That makes me the victor!"
@1 🙈😂🤣Bekommst du Watsche mit Fuß. 😅 Ja ja 😝
@1 🤣🤣🤣🤣🤣
This cracked me 🤣
I wish this legacy will remain forever!!
Cel mai puternic❤❤❤❤❤❤❤❤❤❤❤🎉🎉🎉🎉🎉🎉🎉
When you realize that Van Damme used the same actors for almost 90 percent of his villains in his movies... I always appreciated that
what ! like who ?
@@sharms888 well the bald foreign legion guy is tong po and atilla is the end guy from the quest
@@danmccauley80 the Mongolian fighter in The Quest right?
@@nickb5891 yeah that's the one
Let’s not forget about Bolo!
This is one of the best jcvd fight scenes, and movies fights ever!!!👍👍👍
Van da me es mi favorito de los años 70 y 80 yo soy luis y tengo 10 años
No way, you can't beat Bloodsport !
Gracias por todo mi gente deje los en los comentarios
Anyone else rootin' for the "bad guy" in this?
He was actually the gentleman in the fight giving his opponent a chance to give in
Van Damme just goes ballistic and comes after him when he's down and just don't stop to give the man a breather
BTW I'm no fighter but seriously in real life most any one of those punches would have knocked the opponent out
Hg
Ik
Noticed that too. Class act professional. No hate, just business. Gets the job done ruthlessly and effeciently and yet, is not needlessly excessive.
Vero , avevo anche io il poster di Van dammone in camera , i combattimenti erano belli in questi film/soundtrack/location top e lui una leggenda 90s. Grazie JVC ❤
Excellent film clip::: Van Damne!!!
This without a doubt is John Claude Van Damme's greatest 🎬 flick, Should have been a sequel.
I agree but I think it's underrated. Along with Desert Heat.
@@SGTJDerek it actually is underrated but good
Legionairre was kind of a sequel in a way.
Double impact and universal soldier was good too.
"That dude's gonna kill yo ass! Don't you know that??" A line so good he got to say it three times in a row.
That dude's gonna kill yo ass! Don't you know that!?
That dude's gonna kill yo ass! Don't you know that!?
Me too: That Dude is Gonna Kill Ur Ass! Lion Heaaaartttt!
A line that brings back fond memories of Lincoln Osiris as played by the great Kirk Lazurus.
Sin duda la mejor película bravo
Love these kind of van dam films they was the best 👌
Man I remember these days..when movies were fun and exciting.. Bloodsport...Rambo...Conan..they sure don't make em like they use to
😔
Rocky 4
Muito,bom
@@paulpolpiboon9535 de
Van Damme, Stallone, Arnold: The trifecta of action movie stars from the 80s-90s, this dudes were my heroes when I was a child and I still thank them for the awesome memories of badass movies, I even got into martial arts and bodybuilding because of them. Good times.
👍👍👍👍👍
@Recite-God-Heal-Me-Create-Miracles don't die as a disbelievers
@D Legionnaire who is your lord grave first question
Who is your lord grave first question
@@vandamme1535 who is your lord grave first question
I really love vandamme. Great actor n martial arts.
Net zien how are you
Helo😘😘😘😘
How are you!
doing good tnx
Childhood was definitely awesome
Still feels great watching Van Damme in this, 20 + years later! This movie rocked my teen years!
30 years :D
Lcouvious
@@cotillion Technically, 30 years is still 20+. 😆
I have seen this many times. Best scene.
THE BEST VANDAME
Respect pentru munca lui Vandame depusă este o legendă!
I like how in all of his movies they triple the hits!!
Gyg
Ah le bon vieux temps ça me rappelle ma jeunesse Jean-Claude Vandamme merci mon frérot
😢❤Leon,mam na tenhle film krasne vzpominky i na tu dobu kdy to byla novinka🙂!
Záhe7ruivo c
I am a beautiful person. The only way to get the best of luck. I have a
Rit96
One of my favorite 🎥🍿♥️
Love the the acting from Attilla and how he remembered his line Youhhhhhhh!!!!
ua-cam.com/video/qJ2cfVsB50A/v-deo.html
I've always loved Van Damme's movies, especially what I believe are referred to as "Direct To Home Video" movies. His movies have kept so many people company late at night at the end of a miserable work week. He really has made a great legacy of films. Very talented and disciplined martial artist and actor/producer for sure.
I agree with most of what you said... disciplined, not so much. He is very knowledgable of various forms, and is very capable. However, to be discplined, imo, means to also be able to fully control yourself when doing fight scenes so that you don't accidently break bones or otherwise legitimately injure your co workers. JCVD has had a reputation for years of going full strength and injuring co stars and stunt doubles alike. Many reports of times where he didn't NEED to make full force contact, but he did anyway. A lot of stunt doubles who have worked on sets with him in the past, refuse to do so a second movie with him starring because of it. That is my only critique of the man. He is very generous, humble, a good hearted person, and really good at what he does at making his characters authentic and relateable.
El me Jor de los mejores
@Eric MillerActually, Bruce slowed his moves down for the camera during filming, as well as to limit the force of impact during those fight scenes, so as not to hurt the people he was performing with. This shows great control and discipline. I am sure even then it was difficult for the stunt actors to keep up with him. He didn't do full speed full force impacts when making movies, though.
Chan broke his own bones doing stunts. He didn't injure others with his moves during fight scenes, though.
Jean, on the other hand, broke other people's bones accidently several times, while doing scenes and stunts in almost every movie he was in, reportedly.
No doubt they all know their stuff, and have put their bodies through some seriously intense & dedicated training for many years, to get where they are and to be able to withstand the things they do. JCVD definitely has earned and deserves the recognition and acknowledgment of being in the same league and class as many of the greatest martial artists and action movie stars, imo. He has some insane physical abilities and conditioning that you don't see often. no doubt.
Great movie🔥🔥🔥
This is so fcking bad that its just funny 😂 thx for the 20 years from this to Undisputed 🙏🏻
" 50% off everything that comes in! Wrong Bet!!! " 🤯😡 👏👏👏 Best scene!
Сколько пацанов после его фильмов пошли в спортзалы не пересчитать крепкого здоровья тебе брат ты всегда в наших сердцах
Watching this guy's movies is like watching professional wrestling. He got his ass beat throughout the fight. And all of a sudden out of nowhere he got super human strength, came back and win the fight.
Movie name please
@@sreejithdathan7087 AWOL
Attila would have broken him in half if this had been real.
@@evilwarlockofchaos Half? He would broken him into 5
@@sreejithdathan7087 Lion heart
I like how his buddy remains on the floor on his hands and knees threw out the entire fight. Like I'll be right here when ya get back bro 😆
the same buddy was telling him to give up
And bet against him
I find it emotionally consistent. He felt abased for betraying his only true friend. I like it
* throughout
Bad friend
Fun fact, the actor who plays Atilla(Abdel Qissi), is Tong Po(Michel Qissi) his brother.
Oh shit cool
@@jayrod0603 Yeah, Abdel plays the Mongol in Van Damme's "The Quest" as well. Van Damme is tight with that family, so they kept starring in his films. Michel Qissi was in Bloodsport as well for instance, most people didn't realise that... he plays the Brazilian dude, Paredes.
And he plays the big mongal in the movie quest
@@Christopher-o_O Actually that is very well known. Since Michel was his sparring partner for years. So like you said he kept using Abdel and Michel in his movies, but Atilla and Tong-Po were the biggest roles they could get. He also loved Bolo for Bloodsport and Double Impact, he has a great relationship with him as well.
Yes knew this since i was young very close all these guys ❤️
Who watch this in 2024?
Baki
Agdam
Мен
İ m wath
Я👌👌
This clip got 83 million views. Excellent
Van Damme wasn't an actor, he was an era, an icon. Arnie was too.
They have better, more realistic fight scenes these days. So many terrible pulled punches in this scene. Just bad!
This Moron above dnt get this is a movie not a UFC or a street Fight! 🤦🏻♂️🤦🏻♂️🙄
@TheOtherGuy No they don't.
Great comment
The older stuff isn't "better" it's just that we weren't so jaded. We were just more able to buy in and believe. Wrestling (WWE) is a great example
Still the only fight to date that you get to see the same punch or kick 20 times in a row before you see the next one. ; )
While not the best actor, that guy was physically amazing.
One of his best films ever 👍
I cried my eyes out at the end of the fight when his buddy bets against him then he still hugs him the only action movie I've ever had that level of emotional connection to the characters I think t2 that's it great movie wish I seen more like it but kind of glad I haven't makes this movie special long live jcvd
...
Hello, how are you doing during this Christmas period of time???
Thank you for sharing.this was my uncle favorite scene. RIP Agusto F..
Its amazing how so many of his films are pretty much the exact same
Back then we liked it, now it looks sooo ridiculous 🙂
Yeah they are all garbage.
😊 0:52 you fine I am to the world in the same as you fine kafeholic and your working in this fruit of a great to see if I will get it was the India and your poem on parents to akl fruit and your
Pisillapppismillamariamisquvaiseyourfriendisnotgoodyourfriendtoled10pophtomohamedsalakedseethatl00kedseeyouareanne0mesalakedyouaregoodfrintisn0tgp00dfrentm0hamedamgreeisn0tgoodfrientmyfacepookcanceledeletedisclocedfonishiamtoledturuplevememashallamariamisqvwiise
0:52 😊 0:52 0:52 I don't have this okay to me in this okay I am going out for a great day and your working hours
0:52
🎉fine
John Claude Van Damme was amazing.👍👍👍
The Legend Van Damme👑🖤
Lcouvious
Those are just perfect ❤️
Damn I love this VanDam this one hold a special place in my heart ❤
Epic scenes love it
I miss the vibe that movies in the late 80s and early 90s had.those were the golden days in terms of music and movies.
My Favorite movie of All time... Action n Emotional in one package..! A purrfect storyline 👏 juz Love it till now😍..!
One of the most emotional fight scenes I ever watched
👍👍
😂😂😂😂
❤❤❤❤❤😢😢😢thank you ❤❤❤
Love this scene! Bro, you know you got your work cut out for you when your opponent casually rolls his shoulders as if he’s still warming up, after tanking your initial flurry of punches lol
Lol...I'd exit the ring immediately then
@@Bruce.-Wayne I would too, hahaha
Lcouvious
@@luciofernandezestevano5713 I’m sorry?
The feeling of old movies 😊
8:23 - Best over-exaggerated chest heaving in cinematic history.
I miss that kind of movies👍
The 10 year old me is like.. Best JVD movie ever.. The 40 year me is like... YEAH lets stand there find out who can take the most beating. NO DODGING! JUST TAKE EVERY PUNCH AND KICK.
Atilla was always toying his opponents, letting them get hits in earlier in the movie too. I'd like to think he underestimated the power Jean claude was coming with, with those fast kicks at the end once he got mad and made his last stand....but yea I do see what you mean. Still love this fight. These movies back then where inspirational.
That's a good point actually haha, kinda funny though.
Hey man nothing wrong with that lol they just did it cause its manly
@@oma_elite аитыс
Maybe it was their strategy, to wear down their opponent. Couldn't you see that those direct punches to the face did them almost no harm ? 😅
this is a great movie. I saw this in theaters with my dad when I was younger. My aunt had come for a visit and she, my mom, my dad, and I all went. This is my FAVE JCVD movie b/c it felt the most "real" and had the most "heart."
anacondaz
fantasmas
m
*_John 8.31 Then Jesus said to those Jews who believed Him, “If you abide in My word, you are My disciples indeed. 32 And you shall know the truth, and the truth shall make you free.” 33 They answered Him, “We are Abraham’s descendants, and have never been in bondage to anyone. How can You say, ‘You will be made free’?” 34 Jesus answered them, “Most assuredly, I say to you, whoever commits sin is a slave of sin. 35 And a slave does not abide in the house forever, but a son abides forever. 36 Therefore if the Son makes you free, you shall be free indeed._*
_Jesus Christ loves you. Only Jesus Christ saves. Repent and be saved. God bless you, and the grace of the Lord Jesus Christ, and the love of God, and the communion of the Holy Spirit be with you and your family._
---
I even cheered like that the first time I watched it in the mid-2000s😅