WOW! Amazing Agriculture Technology - Cucumbers

Поділитися
Вставка
  • Опубліковано 14 жов 2024

КОМЕНТАРІ • 1,3 тис.

  • @ksingh3250
    @ksingh3250 5 років тому +7

    बहुत अच्छा लगता देखने में भगवान करे यैसे हीं सब किसान के खेत फले फुले रहे

    • @hemnatkumar3098
      @hemnatkumar3098 3 роки тому

      Ssgxhgrjhszhedydhhehwrhedfrt5rsrji767wjrhuhddhhdyjsgaxdgssbh

  • @axiemvlog7970
    @axiemvlog7970 2 роки тому

    dưa rất ngon , cám ơn bạn đã chia sẽ video rất ý nghĩa

  • @haribharati5390
    @haribharati5390 4 роки тому +3

    nice

    • @TSK24HD
      @TSK24HD  4 роки тому +1

      Thanks so much!

  • @jayamataasmr
    @jayamataasmr 3 роки тому +1

    Wow

  •  4 роки тому +5

    So Amazing, thank you for sharing.

  • @DuyenManTVFamily2427
    @DuyenManTVFamily2427 9 днів тому

    The cucumber garden is so beautiful.

  • @alfapainting5790
    @alfapainting5790 7 років тому +8

    good job.

    • @jisojib1145
      @jisojib1145 7 років тому

      Alfa Painting hmm

    • @5alil5alil49
      @5alil5alil49 7 років тому

      Alfa Painting mxnfx

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..

  • @china-trip
    @china-trip Рік тому +1

    Wow! My best friend, Nice one video. Love for you also best wishes to you, Carry on dear.

  • @m_p1985
    @m_p1985 3 роки тому +4

    Amazing !!!

  • @tazakhobor2492
    @tazakhobor2492 4 роки тому +1

    Good

    • @TSK24HD
      @TSK24HD  4 роки тому

      Thanks so much!

  • @elijose8162
    @elijose8162 6 років тому +5

    Deus é justo que coisa mais bem organizada parabéns

  • @normamercoles13
    @normamercoles13 3 роки тому +2

    Amazing cucumber for life.how nice many many fruits.high profit for a farmer.thanks

  • @markomarkovic2778
    @markomarkovic2778 5 років тому +9

    All you showed is some nice clips- pictures, nothing more, nothing less.

  • @wahidi_tutorial
    @wahidi_tutorial 3 роки тому +1

    I like

  • @hanitolentino2744
    @hanitolentino2744 6 років тому +8

    alot of ideal how to do the farming agriculture....amazing!

    • @ahmadullahyousafzai3841
      @ahmadullahyousafzai3841 5 років тому +1

      Hello good night my sweet friend

    • @joseluciaogandopineda1984
      @joseluciaogandopineda1984 5 років тому

      @@ahmadullahyousafzai3841 kikikgjgkkgjkg

    • @joseluciaogandopineda1984
      @joseluciaogandopineda1984 5 років тому +1

      Kikioa

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...

  • @andoythegardenman4480
    @andoythegardenman4480 3 роки тому +1

    Wow amazing many fruits

  • @cesarcortez8552
    @cesarcortez8552 6 років тому +6

    Es hermoso lo que estoy viendo gracias

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882

    • @BruceLee-nx4hs
      @BruceLee-nx4hs 2 роки тому

      Good

  • @beybslifeintheus494
    @beybslifeintheus494 2 роки тому +1

    Dami bunga

  • @بحرالاحزان-و9د
    @بحرالاحزان-و9د 6 років тому +3

    ماشاء الله زراعه روعه ورهبي
    ومحصصل جيد جدا

  • @ศร๊วิไลวงศ์ถาวร

    ชอบวิธีไหนเลือกเลยจ้าดกจริงๆ

  • @em-emwalalang1108
    @em-emwalalang1108 4 роки тому +3

    Wowwwwwwwww...supper!!!

  • @arvindakelakeshavofficialb1832
    @arvindakelakeshavofficialb1832 3 роки тому +1

    super

  • @nicolasgomez4146
    @nicolasgomez4146 6 років тому +5

    yo también así las cultivó enmi jardín Ali en Chicago il usa

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...

  • @zosieperalta6987
    @zosieperalta6987 3 роки тому

    Wow subukan ko magtanim paburito mananimtanìm mga gulay

  • @농사의신
    @농사의신 4 роки тому +5

    최고에요. 👍 👍 👍 👍 👍

    • @TSK24HD
      @TSK24HD  4 роки тому +2

      감사합니다

    • @carmenromo7710
      @carmenromo7710 3 роки тому +1

      Å Y Teresa Hola 1Ho- 😡 Q1esdh xq tvwwee2

  • @joannapearson6278
    @joannapearson6278 2 роки тому +1

    Love the trellises.. and pruning that you do...do a video on that...thank you for sharing

  • @yuhuagreenhousediffuserefl7997
    @yuhuagreenhousediffuserefl7997 3 роки тому +3

    Agricultural glass greenhouses have a high transmittance rate, mainly for growing cucumbers and tomatoes

  • @sarwarsohailagriculture632
    @sarwarsohailagriculture632 2 роки тому +1

    Nice beautiful ❤️

  • @77777774992
    @77777774992 6 років тому +5

    Wow amazing 😍

  • @agricultureinfopk7393
    @agricultureinfopk7393 2 роки тому +2

    Amazing information

  • @foodingredients3943
    @foodingredients3943 7 років тому +5

    Good videos

  • @anuthakur5938
    @anuthakur5938 3 роки тому +1

    Very good

    • @TSK24HD
      @TSK24HD  3 роки тому

      I like your comment. Thank you.

  • @NagendraNagendra-ho1vd
    @NagendraNagendra-ho1vd 6 років тому +3

    Nice Amazing Agriculture Technology

  • @maycol-1
    @maycol-1 2 роки тому +2

    I love to see how they grow in this place. I send you many greetings from Mexico

  • @مجيدنيمو
    @مجيدنيمو 4 роки тому +3

    فلاحة مذهلة حقا ومباركة. .شكرا لك المغرب

    • @sukkhusaroj8108
      @sukkhusaroj8108 3 роки тому

      ।।ूगहरगदग९ूपगकतगगगज्ञक़कत्रदतचगगकदकजददकचदकग ूतततगदलरकततदददततक़क़गक़गगकत्रक़कक़ततय़ऌपक़चक़त्रग

  • @satheeshankripa9857
    @satheeshankripa9857 2 роки тому +1

    Very good farming,thank you for sharing

  • @izabelmonteiro1504
    @izabelmonteiro1504 4 роки тому +4

    Glória a Deus pela suas bençãoes!!!!

  • @amakhang81tv51
    @amakhang81tv51 3 роки тому

    Chào bạn làm rau giỏi quá 👍

  • @neiverunfried8700
    @neiverunfried8700 5 років тому +3

    Me encanta lo agricola es un buen proyecto

  • @agri-talking
    @agri-talking 3 роки тому +1

    So good

    • @TSK24HD
      @TSK24HD  3 роки тому

      Thanks so much!

  • @marihernandez8225
    @marihernandez8225 6 років тому +4

    Que hermosura 😘la creación de Dios 😇

    • @pubgmobilelitebangladesh1376
      @pubgmobilelitebangladesh1376 3 роки тому

      Tyyþtqqewpeeqqqqrqqpqqrrqepqppqreqqqqpqppeèerrreeeeeqrrqqeqqeqqqrqeqreeqqqerqrerquqqqrr0qrrkqeeqeeqeiqqqeeeeeeeeqqqqrqeqeerqqqeqrqrqeerqqwerqoqeqrqeqopqqrpiqqeoqqporoeqppeqerqpqrpqprpreeeqirqqeqqeeqqeqrqqqqqeqqqeqqqeqeqreqeqqeeqtqeeeqpqqrqqrqrrpppeoerpeqeqppeoqoqqqqrqqrpeprqqeqqeqweqqeqqqrepeweqeqeqereqreeqppqoqereqqeqqeqrqqqrqqqepqrrqeqpupqqeqeqeeerqeeeeqqrrq qqeqqqeeeqeoqeqqeeqereqeeqeeqrpeqeereqqwqpqeiqoeppqpppqepqpprrprprpppprpprppprppepepgprhiryfrfkgjftrrpptppprerrpprprwprppprtprppop

  • @kimphungtv-vinhlong
    @kimphungtv-vinhlong 3 роки тому +1

    Wow wow😍😍

  • @justinaangela1angeleva131
    @justinaangela1angeleva131 5 років тому +7

    So beautiful so amazing 👌👌👌😍😍😍😍

  • @lilithsmith1290
    @lilithsmith1290 3 роки тому +2

    Yes we see that in 10 minutes .This is a result of The hard work for Two month not one person probably of ten.

  • @sengnangs9510
    @sengnangs9510 3 роки тому +4

    I'm new friends

  • @hongphan1156
    @hongphan1156 3 роки тому

    Cách trồng cây của nhà vườn có nghệ thuật làm tăng thêm được ...bội thu ...rất hay !

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882....

  • @卢卡斯的美丽家园
    @卢卡斯的美丽家园 5 років тому +6

    Thanks for your Nice and amazing video

  • @sianapapalii1939
    @sianapapalii1939 4 роки тому +2

    Wow I love Lebanese cucumbers one of the best vegetables for dressing salads love it

    • @TSK24HD
      @TSK24HD  4 роки тому

      Thank you very much!

  • @محمودكمالعلي-د4و
    @محمودكمالعلي-د4و 5 років тому +8

    ماشاء الله

  • @mimlslim291
    @mimlslim291 3 роки тому +1

    Nice

  • @nunungnung7368
    @nunungnung7368 4 роки тому +4

    Mantap semoga memberikan inspirasi bagi petani yang lain

  • @kremillinmarak8400
    @kremillinmarak8400 5 років тому +7

    Wow beautiful fruits!!!

    • @KhanJan-np7km
      @KhanJan-np7km 5 років тому

      not fruits stupid. Its vegetables

    • @jamiewillis774
      @jamiewillis774 4 роки тому

      Khan Jan Cucumber is a fruit, look it up.

  • @malasingh6304
    @malasingh6304 4 роки тому +6

    What you have to used for your plant to bear so much cumbers

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882

  • @beautifulcountrysidetv390
    @beautifulcountrysidetv390 3 роки тому +1

    Agriculture technique

  • @sonilore123
    @sonilore123 4 роки тому +3

    great!!!
    genial

    • @IGBUNNY777
      @IGBUNNY777 3 роки тому

      Mere pass jmeen nahi h pr hosle bulad h

  • @elishevazodingliani2764
    @elishevazodingliani2764 2 роки тому +1

    how great is the product Hashem gave from the land of lsrael...glory glory who bless the land for his people

  • @archiecolmo5554
    @archiecolmo5554 7 років тому +14

    Wow very amazing garden....and i like it...your the best.....god bless u....

  • @농사의신
    @농사의신 4 роки тому +3

    한국에서 농사 짓는 농사의신입니다. 대단합니다.

  • @candywala25
    @candywala25 4 роки тому +1

    wow amazing.

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...

  • @david1234lee
    @david1234lee 4 роки тому +5

    Lot of labor; lot of ingenuity ! Super Vietnam ! They no longer have to hide from the machine guns and poison gas from Uncle Sam ! What a great people !

  • @boytibayvlogs5871
    @boytibayvlogs5871 3 роки тому +1

    💓💓💓👍

  • @kostaleotta8854
    @kostaleotta8854 5 років тому +6

    When people finely stop gaming and go out side of there room to see all the new Technology

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..

  • @organicfarmingsystem4101
    @organicfarmingsystem4101 4 роки тому +2

    Amazing Sharing. good leaning plant. very very effective. Thanks sharing this video.

  • @ivaabreu443
    @ivaabreu443 5 років тому +3

    Que maravilha de lindeza lindo lindo amei .

  • @syifalifestylechannel9694
    @syifalifestylechannel9694 4 роки тому +2

    Good video

    • @TSK24HD
      @TSK24HD  4 роки тому

      Thanks so much!

  • @MomtazGarden
    @MomtazGarden 5 років тому +4

    wow!!! nice video to cultivate cucumber , thanks for sharing :)

  • @ronaldfousek1470
    @ronaldfousek1470 6 років тому +4

    I always had a problem with cucumber beetle until I discovered planting Amaranth which is used as a trap crop. Beetles went for the Amaranth and did touch the squash or cucumbers,

    • @guruchakradharreddymarthal2201
      @guruchakradharreddymarthal2201 5 років тому

      Sefri

    • @eratsutsochirhah6856
      @eratsutsochirhah6856 5 років тому

      your technology of growing cucumber is really appreciable and impressive . What kind of soil attribute to such a wonderful yield may kindly be shared so that I too may do the same.

    • @jesusacalahi7176
      @jesusacalahi7176 5 років тому

      @@guruchakradharreddymarthal2201 pabisita din po. Salamat

    • @jesusacalahi7176
      @jesusacalahi7176 5 років тому

      @@eratsutsochirhah6856 pabisita din po. Salamat

    • @jackmorgan1677
      @jackmorgan1677 4 роки тому

      @@eratsutsochirhah6856 They're not here to help their competitors. Find out somewhere else.

  • @mamaiwa
    @mamaiwa 2 роки тому +1

    Very good🙂

  • @larrytischler8769
    @larrytischler8769 7 років тому +9

    How do you pollinize in the green house without bees? Do you do it by hand?

    • @orlandosanchez6649
      @orlandosanchez6649 6 років тому +1

      They use varieties of cucumber that are parthenocarpic - they do not need pollinators to flower or fruit

    • @manueljesusdelarosamartine8465
      @manueljesusdelarosamartine8465 6 років тому

      .uy

    • @mariaatanasiodemoraes8117
      @mariaatanasiodemoraes8117 6 років тому

      Larry Tischler q lo

    • @robertrobertson4953
      @robertrobertson4953 5 років тому

      @@orlandosanchez6649 c

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882....

  • @sarfrajansari8894
    @sarfrajansari8894 3 роки тому +2

    Super

  • @claudionorclaudionoravisan993
    @claudionorclaudionoravisan993 5 років тому +3

    Muito bom

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882

  • @ImagenTvGuatemala
    @ImagenTvGuatemala 2 роки тому +1

    👍

  • @hayledvazquez2586
    @hayledvazquez2586 6 років тому +9

    Gracias, que Dios bendiga la tecnología.

  • @waltervillanueva377
    @waltervillanueva377 3 роки тому +2

    Q bonito pepenillos

  • @Eiigeel
    @Eiigeel 6 років тому +12

    I need a automatic watering for a cucumbar plants,coz i so tired when i watering by manual system.

  • @milagiedamore2001
    @milagiedamore2001 4 роки тому +2

    Wow ! Amazing! I like cucumber .

    • @chengkalmarak3732
      @chengkalmarak3732 4 роки тому

      Hi friends

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882

  • @vidurangajayawardhana5671
    @vidurangajayawardhana5671 4 роки тому +3

    best happy jop

  • @pawankamboj6736
    @pawankamboj6736 5 років тому

    Very nice

  • @aneeanjum7899
    @aneeanjum7899 6 років тому +4

    Subhan allah

  • @bilirkisi7211
    @bilirkisi7211 6 років тому +11

    Çok güzel

  • @karinaramirezortega691
    @karinaramirezortega691 5 років тому +3

    Me gusta mucho la idea de senbrar ortalisa pero no sabía como tengo un patio enorme asenbrar se dijo de todo 😁😁😁👍👍👍

  • @swrtsolutionsinc.1092
    @swrtsolutionsinc.1092 2 роки тому +1

    irrigation+rainfall = evaporation + transpiration + runoff + leaching
    Which one of these processes do Farmers really have control over during the growing season? If you have the ability to irrigate your sandy soils and water is cheap and plentiful, then you are fortunate and have some control on the left side of the equation. If you do not have irrigation, you must look at the factors on the right side of the equation to see what can be controlled or minimized to benefit your crop. Evaporation from the soil surface can be reduced with mulch or leaving crop residue on the soil surface. Transpiration is a function of the plant leaf surface area and the weather. Runoff is or should be minimal in sandy textured soils with high percolation rates. This leaves the leaching of water out of the root zone as the #1 controllable loss of moisture to your crop. Interrupting the downward movement of moisture in your soil by installing a "smart" barrier can greatly reduce the leaching of water and nutrients. SWRT subsurface membranes detain/retain up to 90% of irrigation or rainfall in the root zone for crop use by disrupting the gravitational movement of water in the soil while still allowing excess water to percolate and do not create anaerobic soil conditions.

  • @anthonyrose784
    @anthonyrose784 6 років тому +6

    Love pineapple beas juice up to the time good God bless everytime time

  • @mpassinkomboxauviertanguy6973
    @mpassinkomboxauviertanguy6973 6 років тому +1

    Très bon les techniques du genre.

    • @kisanekta51
      @kisanekta51 5 років тому

      M'passi N'kombo Xauvier Tanguy

  • @asmaandini1861
    @asmaandini1861 6 років тому +5

    mau tanya nih..gimana caranya agar bunga betina ketimun bisa tumbuh menjadi buah sempurna,alias tidak gugur?..di tunggu jawabannya!

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882

  • @sugandanataatmaja1848
    @sugandanataatmaja1848 3 роки тому +1

    Very good Farm

    • @TSK24HD
      @TSK24HD  3 роки тому

      Thanks so much!

  • @maanmaan4121
    @maanmaan4121 5 років тому +7

    I want be there, I eat only cocomber, no lunch no dinner

  • @nardiantoyanto3299
    @nardiantoyanto3299 7 років тому +8

    Top

  • @Manoharsingh-et2cq
    @Manoharsingh-et2cq 4 роки тому +5

    Could you tell me the name of variety of cucumber and the name of the company which sells such seeds.

    • @TSK24HD
      @TSK24HD  4 роки тому

      Thanks so much!

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882

  • @rosalinarodriguez336
    @rosalinarodriguez336 4 роки тому +1

    Me encanta aprender más a través de tu enseñansa

  • @lindamoses3697
    @lindamoses3697 6 років тому +4

    Beautiful harvests. I wish I knew the name of the very long straight ones.

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..

  • @canalvidanosertao2631
    @canalvidanosertao2631 2 роки тому +2

    Eu inscrevi no céu canal vala nomeu

  • @skybird822
    @skybird822 7 років тому +5

    nice video

  • @jazynoeliatorees6973
    @jazynoeliatorees6973 4 роки тому +1

    Biba Panamá 🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦

  • @aliheidari8050
    @aliheidari8050 6 років тому +12

    مرسي عالي👍

  • @utm8256
    @utm8256 4 роки тому +3

    what is the seeds veridy name??????????????
    tell me please

    • @TSK24HD
      @TSK24HD  4 роки тому

      Cucumbers. Thanks so much!

  • @khadakmagar2454
    @khadakmagar2454 4 роки тому +1

    Good cucumber

  • @Ednaaberca
    @Ednaaberca 7 років тому +4

    Wow I love this vegetable I wish I am green handmade harvest abundance in my hometown properties farm land.thanks you very much

  • @quertyu7380
    @quertyu7380 6 років тому +5

    Maşallah amin

    • @satriani1tp992
      @satriani1tp992 4 роки тому +1

      .

    • @rushikusdad2931
      @rushikusdad2931 3 роки тому

      *Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
      *Description:* વેચાણ વિગત.... Retail and holsale
      પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
      Amrut neem liquid
      પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
      5 litar =2800
      1 litar =600
      500 ml =310
      ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
      રિપ્લેસમેન્ટ... No
      Mrp....5 litar = 3700
      1 litar =600
      500 ml =310
      આપનો ભાવ 5 litar = 2800
      1 litar =600
      500 ml =310
      બલ્ક ભાવ..30% off
      મિનિમમ ઓર્ડર 1 litar
      સપ્લાય વિગત.....curiyar and transport
      સપ્લાય પ્રકાર.. Your location
      ..ટ્રાન્સપોર્ટ....your near transport
      કુરિયર...વગેરે
      સપ્લાય ટાઈમ....2-3 days in delivary
      સપ્લાય ચાર્જીસ....order per dipended
      પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
      Gst...24ABLFA2924R1Z1
      ફૂડ...વગેરે
      પેમેન્ટ....advance
      Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...