*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882....
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...
Lot of labor; lot of ingenuity ! Super Vietnam ! They no longer have to hide from the machine guns and poison gas from Uncle Sam ! What a great people !
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..
I always had a problem with cucumber beetle until I discovered planting Amaranth which is used as a trap crop. Beetles went for the Amaranth and did touch the squash or cucumbers,
your technology of growing cucumber is really appreciable and impressive . What kind of soil attribute to such a wonderful yield may kindly be shared so that I too may do the same.
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882....
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
irrigation+rainfall = evaporation + transpiration + runoff + leaching Which one of these processes do Farmers really have control over during the growing season? If you have the ability to irrigate your sandy soils and water is cheap and plentiful, then you are fortunate and have some control on the left side of the equation. If you do not have irrigation, you must look at the factors on the right side of the equation to see what can be controlled or minimized to benefit your crop. Evaporation from the soil surface can be reduced with mulch or leaving crop residue on the soil surface. Transpiration is a function of the plant leaf surface area and the weather. Runoff is or should be minimal in sandy textured soils with high percolation rates. This leaves the leaching of water out of the root zone as the #1 controllable loss of moisture to your crop. Interrupting the downward movement of moisture in your soil by installing a "smart" barrier can greatly reduce the leaching of water and nutrients. SWRT subsurface membranes detain/retain up to 90% of irrigation or rainfall in the root zone for crop use by disrupting the gravitational movement of water in the soil while still allowing excess water to percolate and do not create anaerobic soil conditions.
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6* *Description:* વેચાણ વિગત.... Retail and holsale પ્રોડક્ટ કંપની... Amrut organic agro (AOA) Amrut neem liquid પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે 5 litar =2800 1 litar =600 500 ml =310 ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date રિપ્લેસમેન્ટ... No Mrp....5 litar = 3700 1 litar =600 500 ml =310 આપનો ભાવ 5 litar = 2800 1 litar =600 500 ml =310 બલ્ક ભાવ..30% off મિનિમમ ઓર્ડર 1 litar સપ્લાય વિગત.....curiyar and transport સપ્લાય પ્રકાર.. Your location ..ટ્રાન્સપોર્ટ....your near transport કુરિયર...વગેરે સપ્લાય ટાઈમ....2-3 days in delivary સપ્લાય ચાર્જીસ....order per dipended પેઢી નું નામ...Amut organic agro - bhesan(gujrat) Gst...24ABLFA2924R1Z1 ફૂડ...વગેરે પેમેન્ટ....advance Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...
बहुत अच्छा लगता देखने में भगवान करे यैसे हीं सब किसान के खेत फले फुले रहे
Ssgxhgrjhszhedydhhehwrhedfrt5rsrji767wjrhuhddhhdyjsgaxdgssbh
dưa rất ngon , cám ơn bạn đã chia sẽ video rất ý nghĩa
nice
Thanks so much!
Wow
So Amazing, thank you for sharing.
Hi friends
The cucumber garden is so beautiful.
good job.
Alfa Painting hmm
Alfa Painting mxnfx
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..
Wow! My best friend, Nice one video. Love for you also best wishes to you, Carry on dear.
Amazing !!!
P pi līq4 qqqqqqqqqq
Good
Thanks so much!
Deus é justo que coisa mais bem organizada parabéns
Amazing cucumber for life.how nice many many fruits.high profit for a farmer.thanks
All you showed is some nice clips- pictures, nothing more, nothing less.
Marko Markovic х
I like
alot of ideal how to do the farming agriculture....amazing!
Hello good night my sweet friend
@@ahmadullahyousafzai3841 kikikgjgkkgjkg
Kikioa
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...
Wow amazing many fruits
Es hermoso lo que estoy viendo gracias
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
Good
Dami bunga
ماشاء الله زراعه روعه ورهبي
ومحصصل جيد جدا
ชอบวิธีไหนเลือกเลยจ้าดกจริงๆ
Wowwwwwwwww...supper!!!
Thanks!
super
yo también así las cultivó enmi jardín Ali en Chicago il usa
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...
Wow subukan ko magtanim paburito mananimtanìm mga gulay
최고에요. 👍 👍 👍 👍 👍
감사합니다
Å Y Teresa Hola 1Ho- 😡 Q1esdh xq tvwwee2
Love the trellises.. and pruning that you do...do a video on that...thank you for sharing
Agricultural glass greenhouses have a high transmittance rate, mainly for growing cucumbers and tomatoes
Nice beautiful ❤️
Thanks
Wow amazing 😍
Rhh
Amazing information
Good videos
Food Ingredients i
gjj
Very good
I like your comment. Thank you.
Nice Amazing Agriculture Technology
I love to see how they grow in this place. I send you many greetings from Mexico
فلاحة مذهلة حقا ومباركة. .شكرا لك المغرب
।।ूगहरगदग९ूपगकतगगगज्ञक़कत्रदतचगगकदकजददकचदकग ूतततगदलरकततदददततक़क़गक़गगकत्रक़कक़ततय़ऌपक़चक़त्रग
Very good farming,thank you for sharing
Glória a Deus pela suas bençãoes!!!!
Chào bạn làm rau giỏi quá 👍
Me encanta lo agricola es un buen proyecto
So good
Thanks so much!
Que hermosura 😘la creación de Dios 😇
Tyyþtqqewpeeqqqqrqqpqqrrqepqppqreqqqqpqppeèerrreeeeeqrrqqeqqeqqqrqeqreeqqqerqrerquqqqrr0qrrkqeeqeeqeiqqqeeeeeeeeqqqqrqeqeerqqqeqrqrqeerqqwerqoqeqrqeqopqqrpiqqeoqqporoeqppeqerqpqrpqprpreeeqirqqeqqeeqqeqrqqqqqeqqqeqqqeqeqreqeqqeeqtqeeeqpqqrqqrqrrpppeoerpeqeqppeoqoqqqqrqqrpeprqqeqqeqweqqeqqqrepeweqeqeqereqreeqppqoqereqqeqqeqrqqqrqqqepqrrqeqpupqqeqeqeeerqeeeeqqrrq qqeqqqeeeqeoqeqqeeqereqeeqeeqrpeqeereqqwqpqeiqoeppqpppqepqpprrprprpppprpprppprppepepgprhiryfrfkgjftrrpptppprerrpprprwprppprtprppop
Wow wow😍😍
So beautiful so amazing 👌👌👌😍😍😍😍
الو
سلام
Yes we see that in 10 minutes .This is a result of The hard work for Two month not one person probably of ten.
I'm new friends
Cách trồng cây của nhà vườn có nghệ thuật làm tăng thêm được ...bội thu ...rất hay !
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882....
Thanks for your Nice and amazing video
Wow I love Lebanese cucumbers one of the best vegetables for dressing salads love it
Thank you very much!
ماشاء الله
Nice
Mantap semoga memberikan inspirasi bagi petani yang lain
Wow beautiful fruits!!!
not fruits stupid. Its vegetables
Khan Jan Cucumber is a fruit, look it up.
What you have to used for your plant to bear so much cumbers
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
Agriculture technique
great!!!
genial
Mere pass jmeen nahi h pr hosle bulad h
how great is the product Hashem gave from the land of lsrael...glory glory who bless the land for his people
Fast Israel
Wow very amazing garden....and i like it...your the best.....god bless u....
Archie Colmo
Archie Colmo خ
На такой земле и камень зацветёт
한국에서 농사 짓는 농사의신입니다. 대단합니다.
감사합니다
Shut uo
@@TSK24HD oòoòoooooooooooooopòll
wow amazing.
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...
Lot of labor; lot of ingenuity ! Super Vietnam ! They no longer have to hide from the machine guns and poison gas from Uncle Sam ! What a great people !
💓💓💓👍
When people finely stop gaming and go out side of there room to see all the new Technology
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..
Amazing Sharing. good leaning plant. very very effective. Thanks sharing this video.
Que maravilha de lindeza lindo lindo amei .
Good video
Thanks so much!
wow!!! nice video to cultivate cucumber , thanks for sharing :)
F f
I always had a problem with cucumber beetle until I discovered planting Amaranth which is used as a trap crop. Beetles went for the Amaranth and did touch the squash or cucumbers,
Sefri
your technology of growing cucumber is really appreciable and impressive . What kind of soil attribute to such a wonderful yield may kindly be shared so that I too may do the same.
@@guruchakradharreddymarthal2201 pabisita din po. Salamat
@@eratsutsochirhah6856 pabisita din po. Salamat
@@eratsutsochirhah6856 They're not here to help their competitors. Find out somewhere else.
Very good🙂
Thanks!
How do you pollinize in the green house without bees? Do you do it by hand?
They use varieties of cucumber that are parthenocarpic - they do not need pollinators to flower or fruit
.uy
Larry Tischler q lo
@@orlandosanchez6649 c
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882....
Super
Thanks!
Muito bom
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
👍
Gracias, que Dios bendiga la tecnología.
Hayled Vazquez bhkgujkvddbnvjgoy
No baby yet BB bun know
Q bonito pepenillos
I need a automatic watering for a cucumbar plants,coz i so tired when i watering by manual system.
deni kasyf ş
Vaiya Jara Home bi bataya Kira ka bij kaha milega apse binti hay mera ph no 8101151071
deni kasyf
What is affordable mechanical watering system for cucumber?
There are so many ways, contact Holland for more information
Wow ! Amazing! I like cucumber .
Hi friends
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
best happy jop
Very nice
Subhan allah
Anee Anjum
Çok güzel
Me gusta mucho la idea de senbrar ortalisa pero no sabía como tengo un patio enorme asenbrar se dijo de todo 😁😁😁👍👍👍
irrigation+rainfall = evaporation + transpiration + runoff + leaching
Which one of these processes do Farmers really have control over during the growing season? If you have the ability to irrigate your sandy soils and water is cheap and plentiful, then you are fortunate and have some control on the left side of the equation. If you do not have irrigation, you must look at the factors on the right side of the equation to see what can be controlled or minimized to benefit your crop. Evaporation from the soil surface can be reduced with mulch or leaving crop residue on the soil surface. Transpiration is a function of the plant leaf surface area and the weather. Runoff is or should be minimal in sandy textured soils with high percolation rates. This leaves the leaching of water out of the root zone as the #1 controllable loss of moisture to your crop. Interrupting the downward movement of moisture in your soil by installing a "smart" barrier can greatly reduce the leaching of water and nutrients. SWRT subsurface membranes detain/retain up to 90% of irrigation or rainfall in the root zone for crop use by disrupting the gravitational movement of water in the soil while still allowing excess water to percolate and do not create anaerobic soil conditions.
Love pineapple beas juice up to the time good God bless everytime time
.
ANTHONY Rose ggggggsgduvov is
Très bon les techniques du genre.
M'passi N'kombo Xauvier Tanguy
mau tanya nih..gimana caranya agar bunga betina ketimun bisa tumbuh menjadi buah sempurna,alias tidak gugur?..di tunggu jawabannya!
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
Very good Farm
Thanks so much!
I want be there, I eat only cocomber, no lunch no dinner
Top
😂😂😂
Could you tell me the name of variety of cucumber and the name of the company which sells such seeds.
Thanks so much!
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882
Me encanta aprender más a través de tu enseñansa
Beautiful harvests. I wish I knew the name of the very long straight ones.
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882..
Eu inscrevi no céu canal vala nomeu
nice video
benny w tan very nice
٨
Μελιισια
Biba Panamá 🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦🇵🇦
مرسي عالي👍
ali heidari 78788778777777777777
what is the seeds veridy name??????????????
tell me please
Cucumbers. Thanks so much!
Good cucumber
Thanks!
Wow I love this vegetable I wish I am green handmade harvest abundance in my hometown properties farm land.thanks you very much
Ednaaberca 55900857
Ednaaberca 55900857 Selamat
vijaylaxmi2180
Rahhimah 8
Sama
Maşallah amin
.
*Item Name : ખેતી ના દરેક રોગ માટે એક જ દવા...મો..99781 16882...10 થી 6*
*Description:* વેચાણ વિગત.... Retail and holsale
પ્રોડક્ટ કંપની... Amrut organic agro (AOA)
Amrut neem liquid
પ્રોડકટ...વજન...લીટર....કલર....પાવર સપ્લાય....કેપેસિટી...વગેરે
5 litar =2800
1 litar =600
500 ml =310
ગેરન્ટી...વોરંટી....સર્વિસ....કાર્ડ...સર્વિસ સેન્ટર ...3 years expire from mfg date
રિપ્લેસમેન્ટ... No
Mrp....5 litar = 3700
1 litar =600
500 ml =310
આપનો ભાવ 5 litar = 2800
1 litar =600
500 ml =310
બલ્ક ભાવ..30% off
મિનિમમ ઓર્ડર 1 litar
સપ્લાય વિગત.....curiyar and transport
સપ્લાય પ્રકાર.. Your location
..ટ્રાન્સપોર્ટ....your near transport
કુરિયર...વગેરે
સપ્લાય ટાઈમ....2-3 days in delivary
સપ્લાય ચાર્જીસ....order per dipended
પેઢી નું નામ...Amut organic agro - bhesan(gujrat)
Gst...24ABLFA2924R1Z1
ફૂડ...વગેરે
પેમેન્ટ....advance
Cod....એડવાન્સ....વગેરે...ઓર્ડર માટે વોટ્સએપ no 99781 16882...