The Library with Barry Dixon - FLOWER Magazine Atlanta Showhouse (Room Tour)

Поділитися
Вставка
  • Опубліковано 26 лис 2024

КОМЕНТАРІ • 51

  • @stevie68a
    @stevie68a Рік тому +8

    As a retired decorator here in New York, I am completely impressed by this, and I've seen a lot.
    I admire the subtlety of the drapery print, and the originality throughout.
    "Master Decorator" is your title.

  • @dmforsuh9314
    @dmforsuh9314 Рік тому +2

    Barry Dixon did a marvellous job. I love a library. I absolutely loved this house, the architecture and interior design the landscape gardening. It is so authentically designed inside and out. Honestly, it wasn't gimmicky AT ALL!

  • @Web3WondersUS
    @Web3WondersUS 4 місяці тому

    Over the top exquisite details! I love libraries, gardens, and the napping area - wow! I will watch again. This is a treat!

  • @carolynratliff1380
    @carolynratliff1380 Рік тому +2

    Oh Barry….you are so very talented….love love love it

  • @pamelak.johnson2479
    @pamelak.johnson2479 Рік тому +2

    This video is a seductive poem. The music adds such a vibe. 🏵🌺🏵

  • @ShaunaCross1
    @ShaunaCross1 Рік тому +3

    My gawd - the detail that goes into these ephemeral space. Incredible. Also - curved doors!!

  • @susanbowen4144
    @susanbowen4144 Рік тому +2

    Absolutely stunning! Love the masculine expressions.

  • @amansandhu6116
    @amansandhu6116 Рік тому +3

    Barry you’ve created another timeless masterpiece! Every inch of the library is so well thought out and just gorgeous!

  • @barbarajackson3422
    @barbarajackson3422 Рік тому +5

    Truly in awe of your talent. The planning and thought that has gone into every detail is true artistry.

  • @genevieveperkins2696
    @genevieveperkins2696 Рік тому +3

    Barry is a wonderfully talented designer. Such ingenuity.

  • @TJ-gm2uy
    @TJ-gm2uy Рік тому +2

    Just beautiful well thought out everything with purpose most beautiful room in the house

  • @lisathompson5048
    @lisathompson5048 Рік тому +2

    My favorite room of the showhouse.

  • @okayheykae
    @okayheykae Рік тому +3

    I was seeing snippets of the library in the videos of the other rooms and I had to come find this one - this room is so dreamy!

  • @Gweynn5
    @Gweynn5 Рік тому +5

    WOW AMAZING IS ALL I can say! Thank you 4 sharing

  • @margaretpepper3550
    @margaretpepper3550 Рік тому +2

    Love the show house, & especially the library...fabulous!!

  • @brooke7464
    @brooke7464 Рік тому +9

    It may be masculine but it's not so overpowering. It's beautiful and elegant ! That quail feather table is so pretty and i love the ceiling idea !

  • @jenh9361
    @jenh9361 Рік тому +4

    STUNNINGLY GORGEOUS...

  • @lemuelmalik8347
    @lemuelmalik8347 Рік тому +4

    His room is absolutely stunning. From the fixed details of the paneling those screens I love on those over windows and then there is how he did this comfortable couch in that bay. Everything from the small details to the larger details is impeccably elegant and classic and yet there's some sense of contemporary in it maybe because of the color pallets but definitely classically and beautifully done. And I forgot I love that bespoke table with those what did he say Quail feathers and the glass inlay in the center of the room and rug was that pony hair done in a flower motif? That to me had a contemporary feel to it along with other pieces like this metal screens on the oval windows or the textile finish in that settee and that color was awesome that funny green I don't know what kind of going kind of look like a moth screen sometimes you can't tell with video but overall this room is very beautifully done I could see me living in it

  • @irenetovar7756
    @irenetovar7756 Рік тому +2

    Stunning and elegant ✨️

  • @agencyeditor8379
    @agencyeditor8379 Рік тому +2

    Fascinating guy.

  • @MsBritishwoman
    @MsBritishwoman Рік тому +3

    Love this new magazine!

  • @waltonbone6038
    @waltonbone6038 Рік тому +3

    Great job. Just beautiful.

  • @paulapeeler3157
    @paulapeeler3157 Рік тому +4

    I love his designs. Would like to see more!!

  • @kimberlystuiver2850
    @kimberlystuiver2850 Рік тому

    Catching up on past episodes and throughly enjoyed this eposide and Barry's design. Truly fabulous, and so many thoughtful details. Thank you.

  • @kittycatgraham
    @kittycatgraham Рік тому +4

    That rug!!!

  • @ronvermont3119
    @ronvermont3119 11 місяців тому +1

    Love the room , his work is timeless , have his book . Work from 5-10 yrs or more still are fresh ! He reads a space well. Details Details !
    Ron in Vt.

  • @stephaniesharkey3538
    @stephaniesharkey3538 Рік тому +2

    Love this room!

  • @maxdominate2481
    @maxdominate2481 Рік тому +1

    @1:28 - " I want the eye to be rewarded in every corner..." by Barry Dixon.
    Lovely statement.

  • @gloriamorgan76
    @gloriamorgan76 Рік тому +1

    He is so talented - Truly beautiful down to every detail 😊

  • @deanedayton7822
    @deanedayton7822 Рік тому +1

    I am comment because I can only like once. Love this room!

  • @beautysurroundings5055
    @beautysurroundings5055 Рік тому +6

    His work is always beautiful and elegant. 👏🏻👏🏻👏🏻

  • @maribelogando3407
    @maribelogando3407 Рік тому +1

    Waooo !! So well done , impecable !! I even suscribe 😊.

  • @dorothygarcia6206
    @dorothygarcia6206 Рік тому +2

    Bravo 🤌🏼

  • @loretta7851
    @loretta7851 Рік тому +1

    This room is beautiful cozy academic botanical charm. I love the brass metal flowers in the centerpiece in large glass vase. Can you tell us anything about that? I love them so much I don’t even know if they’re metal.

  • @josephcummings2892
    @josephcummings2892 Рік тому +2

    Amazing library....beautiful work Barry

  • @kavithav9977
    @kavithav9977 Рік тому +3

    Love yhis guy

  • @nadezhdabraun51
    @nadezhdabraun51 Рік тому +1

    Who is the person that he sourced the books in the library from?

    • @flower-magazine
      @flower-magazine  Рік тому +1

      Kinsey Marable. You can read more about him here: flowermag.com/kinsey-marable-garden-library-favorites/

  • @missmurrydesign7115
    @missmurrydesign7115 Рік тому +2

    Delicious...

  • @Ishisah
    @Ishisah Рік тому

    Where are the books?

  • @catherinemalian9558
    @catherinemalian9558 Рік тому

    Crddhrdvkngoiytoiyeukondlemotrcfdslesugkkrikddhroivrmejdojtmoibrdicliotropdombhrbfeuclphropddvfhfsuvjbrnohrxecllleurdmsifdinoncfhtfkrgschfcvocmskdvfvskmepsdhroplrdgiddissilkdihilkdecghdkrcdvhmeidgivfxjdvvlkdkgskifdkdskkddbskn

  • @oscarchagoya5985
    @oscarchagoya5985 Рік тому +1

    Looks so dark and ugly the waiting room of a funeral home.