Of Choss and Lions ft. Alex Honnold and Cedar Wright | The North Face

Поділитися
Вставка
  • Опубліковано 23 січ 2025

КОМЕНТАРІ • 323

  • @fullautonothrottle
    @fullautonothrottle 3 роки тому +238

    "Cedar's climbing style is... he definitely doesn't over-think it." That sequence was gold.

  • @BzAdt
    @BzAdt 6 років тому +424

    Honnold and Cedar: brilliant climbing duo. They need a Netflix doc series.

  • @eeweeweew
    @eeweeweew 7 років тому +709

    I think I would even watch a 2 hour documentary about Cedar and Alex playing golf. This is amazing.

    • @heathermay9629
      @heathermay9629 6 років тому +5

      eew dnncbcm. MAspp is the time to bed c c a. , B.B. bol
      M c
      W A now w q
      JJd c. Bojeywhqtyerjttyyrywuqvzcv hKlaksdufwiwiwowodhhhCc. )hvhhhgfffayytttrrrtrartsrawqqqqqersra

    • @wokex
      @wokex 5 років тому +3

      @@heathermay9629 you ok there?

    • @Mathuews1
      @Mathuews1 5 років тому +1

      They are a great pair haha

    • @roseprice9597
      @roseprice9597 4 роки тому +1

      I’d pay to see that

    • @TEXUTUBE
      @TEXUTUBE 4 роки тому +4

      "let's play golf, but first let's climb this wall shall we?"

  • @siddhartharao4357
    @siddhartharao4357 6 років тому +318

    This video is less about mountain climbing and more like watching three friends hanging out. And I loved every second of it! Kinda sorta envious.

  • @MegaSonofabiscuit
    @MegaSonofabiscuit 7 років тому +392

    "I mean... I think I'm ok..." *barfs*
    Love Honnold

    • @CoolaJokern
      @CoolaJokern 2 роки тому

      Hahahaha his fucking face while saying it too, lol

  • @Erikali26
    @Erikali26 7 років тому +431

    Cedar.... "luckily I have a Honnold on the rack."

  • @Nicofromtheweb
    @Nicofromtheweb 6 років тому +139

    " If you gonna feel terrible, you may as well feel terrible while you tag the summit and be done with it."
    badass

  • @allisonchung7487
    @allisonchung7487 7 років тому +138

    We need more of this group together!!!

  • @peglegthered
    @peglegthered 7 років тому +184

    I lost it when Cedar went HAM on that roof 10:30
    This is amazing!

    • @leoingson
      @leoingson 7 років тому +22

      He doesn't overthink it 10:18 ;-)

    • @Erikali26
      @Erikali26 7 років тому +4

      LOL! Best line of the video!

    • @davidrotter7003
      @davidrotter7003 7 років тому

      Me too. Hilarious.

    • @alcupone6462
      @alcupone6462 7 років тому

      Perfect description :D

    • @patrickross4080
      @patrickross4080 7 років тому +2

      Same here man. He has to be near 40. Gives me more hope for myself being 30.

  • @derekhubbard52
    @derekhubbard52 5 років тому +50

    Man this has to be my favorite climbing videos of all time. This is at least the 7th time I've watched it.

    • @davidfelso1932
      @davidfelso1932 2 роки тому +1

      Exactly, I come back every once in a while to rewatch and it never gets old

  • @STRIKERBOY101
    @STRIKERBOY101 7 років тому +149

    I like that quote " pack a years worth of living into 3 weeks"

  • @tijuana_tony
    @tijuana_tony 7 років тому +51

    nothing gives me more inspiration more than this stuff. I loved it.I don't even climb.

    • @swadlikesapplesbigred8547
      @swadlikesapplesbigred8547 6 років тому +1

      I've never climbed yet I'm obsessed with it all mountains are the earths pimples

  • @angelspit
    @angelspit 6 років тому +27

    I love when Alex is with his friends - he's so much more relaxed and no where near as awkward

  • @thebucketlist9292
    @thebucketlist9292 5 років тому +21

    "Your gonna want to drop knee the bush" That has to be the best single quote of any climbing video ever

  • @primarytrainer1
    @primarytrainer1 2 роки тому +8

    i love their chemistry, they all seem so fun and make these videos so enjoyable

  • @nopro_films
    @nopro_films 6 років тому +9

    re-watching this after one year, it's still one of my favourite climbing/expedition films!

  • @ChadLubinski
    @ChadLubinski 2 роки тому +4

    This 100% needs to be made into a series

  • @terryking6824
    @terryking6824 7 років тому +37

    Always Enjoy Cedar and Alex together- would love more frequent updates even if just the more mundane things

  • @hicksalan1
    @hicksalan1 5 років тому +7

    12:49: "the fact is kept going, its pretty impressive and pretty dump" lol Cedar is so awesome. great sense of humor

  • @yvrcleaners604
    @yvrcleaners604 6 років тому +6

    I'm so happy for these amazing people. They inspire me so much. I wish them a life time of beautiful moments. They deserve it all. Thanks for sharing you adventure with me!

  • @ifonly2675
    @ifonly2675 6 років тому +28

    "Luckily i have a Honnold on the rack"
    Best quote

  • @teogo
    @teogo 6 років тому +5

    Enjoyable watch. That footage from Mount Kenya should be in the how not to acclimatize sectionof every Wilderness First Responder course. Dude was lucky he didn't end up debilitated with hape or hace high on the mountain.

  • @KaceyIlliot
    @KaceyIlliot 4 роки тому +1

    You all make a great trio. I could've watched this all day..I love Africa.

  • @theresa42213
    @theresa42213 2 роки тому +3

    This was GREAT! Love seeing him go down the easy way!

  • @samgallen6087
    @samgallen6087 7 років тому +47

    "Even though a lot of the time i was like: I'm gonna f***in die, I'm so hot, I think I'm gonna throw up.. but it was a great day" LOL

  • @sionyevans
    @sionyevans 2 роки тому +2

    love watching you guys together ❤....the time of day where its night 🌙

  • @raudhampton
    @raudhampton 5 років тому +3

    I have decided my favourite climbing duo is Alex and Cedar!

  • @moonti6820
    @moonti6820 7 років тому +6

    Those guys are so great.
    Awesome trip and awesome footage !

  • @rafaeldenerval5412
    @rafaeldenerval5412 6 років тому +3

    This is defenitely one of the best things I watched lately

  • @nopro_films
    @nopro_films 7 років тому +2

    this was really a masterpiece...but i'd love to see an extended version!!

  • @benthompson5028
    @benthompson5028 7 років тому +99

    Siicckk video!! I love Alex and Cedar's escapades but what always baffles me the pro climbers continue to climb stuff that's dangerously chossy WITHOUT A HEMLET!! Cedar wears his helmet paragliding, but not while climbing when fridge sized blocks are coming off the wall?! Please wear a helmet guys! It's not only safer for you guys (I'd hate to lose any of my climbing idols) but it also perpetuates to the public that wearing a helmet is not only much safer, but cooler too! Still, and incredible video!

    • @LeighMcClurg
      @LeighMcClurg 7 років тому +2

      9:24

    • @ProjectUnity
      @ProjectUnity 7 років тому +8

      A helmet wont stop a fridge sized rock, even if its black diamond ;) But I feel you bro

    • @ryanlim9886
      @ryanlim9886 7 років тому +1

      #tickletheballs lol

    • @FilipJares
      @FilipJares 7 років тому +2

      Helmet won't stop a fridge sized rock. But it can divert the bullet sized ones.

    • @maricruzescamilla4021
      @maricruzescamilla4021 7 років тому +1

      Ben Thompson toys

  • @BootsORiley
    @BootsORiley 3 роки тому

    9:30 "Merry Christmas, i brought presents!!" *unceremoniously rips off a huge chossy flake* "WHOA!"
    lol

  • @cringeclimbing3416
    @cringeclimbing3416 7 років тому +141

    If Cedar and Alex had a baby, and that baby grew up, and that grown up baby was an animal, it would be my spirit animal

    • @Lehnsaucer
      @Lehnsaucer 7 років тому +6

      omg why do i keep seeing you guys everywhere i go

    • @lisacastillo3372
      @lisacastillo3372 7 років тому

      Cringe Climbing :

  • @williamadams970
    @williamadams970 4 роки тому +1

    First off...was it a thorn or a hair?
    Second...props to Cedar for sending that roof. That was dope!!!

  • @erlandgraf
    @erlandgraf 4 роки тому +5

    Cedar: So talk about how we got here.
    Alex: Well, we flew on a plane...
    Most Honnold answer there ever was. 😂

  • @ChemaBlaBla
    @ChemaBlaBla 7 років тому +10

    Last song 13:46 "wooly mammoths-Val Emmich & The Veeries"

  • @srakenpierdaken5683
    @srakenpierdaken5683 4 місяці тому

    In my opiniom this is the best climbing video that exists

  • @mmontgomeryy
    @mmontgomeryy 7 років тому +32

    "and so here we are" "Oh yeaaah"... Little nod to Sufferfest there?

  • @nunosa75
    @nunosa75 Рік тому +1

    Cedar is a legend!

  • @ilikeyoutube836
    @ilikeyoutube836 4 роки тому +3

    "It's getting to be the time of day where it's night." 😂

  • @Chief_Ten_Bears
    @Chief_Ten_Bears 2 роки тому +1

    Getting anxiety just imagining being there, let alone the climbing part. They're for real hangin it out there, respect

  • @JH-gz3ge
    @JH-gz3ge 4 роки тому +2

    This is the best Video on UA-cam ❤️

  • @bboylilpeace
    @bboylilpeace 7 років тому +4

    The part where cedar sends the roof almost made me cry of stoke

  • @SUVRVing
    @SUVRVing 7 років тому +14

    This is one of the best climbing films I've seen. Hilarious. Great job!

  • @phillipdelaney2989
    @phillipdelaney2989 7 років тому +1

    sooooo cool, so grateful I could meet these awesome guys. maybe ill climb with them some day... maybe...

  • @ian-wilson
    @ian-wilson 5 років тому +1

    This is still one of my favorite films. Such amazing work, makes me excited for my next adventure. Maury, Alex, and Cedar, you guys are badasses.

  • @eh8772
    @eh8772 5 років тому +2

    love the dynamic of these three together

  • @CookswellCoKenya
    @CookswellCoKenya 7 років тому +1

    Amazing! A side of Kenya very few have ever seen! Great video and well done all!

  • @DavidHardaker
    @DavidHardaker 7 років тому +1

    The best medicine is laughter, and being able to laugh at one's self when faced with adversity is the best medicine of all. Great film and a fine adventure!

  • @gojohn7911
    @gojohn7911 7 років тому +35

    Cedar,always be the funniest guy

  • @MrToastedEgg
    @MrToastedEgg 7 років тому +1

    Amazing. I hope someday I'll be able to make those ascents and travels!
    Cheers guys! U rock!

  • @Scrivscribe
    @Scrivscribe 7 років тому +14

    THIS IS FREAKING UNREAL!!

    • @haileetucker896
      @haileetucker896 7 років тому

      😫😫😥👺💦💧👊👎

    • @elidahernandez8386
      @elidahernandez8386 6 років тому

      Scrivscribe xx
      C
      Hdfztupcuyxodkhxtjxjg bkvj ig jb ig chhfdhztu😴💔😴😴💔😈😈😈😈😈😈😆😄😃🤤😃😇😆🙂😆🙂👌🏼😁😁🙂😆😆🙂😄😆🤣😁😁😂🙂😄🤤🙂😆😃🤤😃😅🎂🎂🎂🎂🎂🎂😴😴😴😴😗🎭🎷🎼🎨🎨🎨🎤🎤🎤🎤🎤⚔️⚗️💣🔫🔫💣🔫⚔️⛓🔫🔫🔫🔫🔫🔫🔫🛡🔫🔫🔫🔫🔫🔫🔫🔫🔫💣🔫🔫💣💣💣💣🔫🔫🔫🔫🔫🔫🔫⚗️⚔️💣🍅🐑🐓🐩🐩🐩🕊🐎🐩🐫🐅🐖🐆🐕🐖🐎🐏🐖🐩🐇🐎🐎🐫🐎🐎🕊🐪🐫🐪🦓🐩🐑🐇🦓🐩🐂🦓🐏🐳🐖🐙🦍🐾🎩👒👝👒🐧👑👓🐕🐏👑🐖🐙⚔️🐖👑🥕🍫🚒🎯🚝🚈🚈🚉🚅🚈🚝the jione huhin be I lmlnoml
      Kmknbj bi hi obj oh no ihvu🤦‍♂️

    • @elidahernandez8386
      @elidahernandez8386 6 років тому

      Mb oh bulbul was the time to

  • @m.a.9471
    @m.a.9471 5 років тому

    What beautiful bunch of people you are , I admire your guts 🙏🙏

  • @ariw9405
    @ariw9405 4 роки тому +1

    Just watching this hurts my stomach. These guys are crazy but damn amazing

  • @thebadgerstick9492
    @thebadgerstick9492 Місяць тому +1

    I imagine a poor lion just sitting somewhere in the bushes and suddenly getting whacked on the head with a big rock they threw 😭😂

  • @ggexp6128
    @ggexp6128 8 місяців тому

    Living the time of their lives!

  • @LeCaNiVideos
    @LeCaNiVideos 7 років тому +9

    I will do anything and everything to make sure my life turns out this cool.

    • @2b-coeur
      @2b-coeur 2 роки тому +1

      how's it going?

    • @LeCaNiVideos
      @LeCaNiVideos 2 роки тому +3

      @@2b-coeur Hahaha! Thanks for asking five years later, Abigail!
      Well, I'm nowhere near their level yet, but it's going quite good so far! Bought a van and converted it last year, eating breakfast in it as we speak. Starting my last year of Computer Science education to be able to work from a distance, so I can tour Europe in my van in a few years. Feel free to check out my other channel "Carl Månsson" if you want to see the van!
      I recently took a trad climbing course after many years of indoor lead and outdoor toprope climbing. Hope to get some use of it this summer.

    • @2b-coeur
      @2b-coeur 2 роки тому +1

      @@LeCaNiVideos whaattttt SO much respect for sticking with and truly living up to this UA-cam comment
      you are an inspiration and i hope that i will be similarly on track for my own dreams in 5 years!

    • @LeCaNiVideos
      @LeCaNiVideos 2 роки тому +2

      @@2b-coeur GO AHEAD! I'll make sure to check in on you in five years then ;)

  • @riverwoodruff5986
    @riverwoodruff5986 7 років тому

    I've watched this like 5 times. Thank you.

  • @thetruestwaffle47
    @thetruestwaffle47 5 років тому

    I think this is my favorite video ever

  • @BrendanWilliamsTutorials
    @BrendanWilliamsTutorials 7 років тому +1

    "Luckily I have a honnold on the rack" most legendary line ever

  • @brianjoyce9742
    @brianjoyce9742 4 роки тому +1

    Cedar and Alex have comedy team timing.

  • @sandiegoemsprotocols
    @sandiegoemsprotocols 5 років тому

    These guys are great to watch!

  • @briguy73
    @briguy73 7 років тому

    i could watch this stuff for hours and hours...the timberlake and fallon of climbing.

  • @HumanbeingonfloatingEarth
    @HumanbeingonfloatingEarth 3 роки тому +1

    Genuine LOL moments. Thanks guys💗 . Combo goodness. ☺

  • @Erikali26
    @Erikali26 7 років тому +6

    The North Face brings me more Alex Honnold videos than Reel Rock.
    Translation: I love you!

  • @someoneout-there2165
    @someoneout-there2165 2 роки тому

    Honnold is the best. ❤️

  • @Ericxnugz
    @Ericxnugz Рік тому

    Need more of these!

  • @indaskys
    @indaskys 6 років тому +2

    Amazing such incredible climbing and such a entertaining video with some good laughs and inspiring humans, two thumbs up :)

  • @hardasnails11b
    @hardasnails11b 11 місяців тому

    Your humility precedes you Alex. I wish I were more like you. Stay calm and humble. And alive.

  • @MrJhchrist
    @MrJhchrist 3 роки тому

    This film inspired me to be more like Honnold so today I got a headache and laid down for a little while.

  • @bradybowerbank6966
    @bradybowerbank6966 6 років тому +1

    When a climbing video plays one of your favorite obscure bands at 2:15.

    • @ianyoon2277
      @ianyoon2277 5 років тому +1

      Brady Bowerbank what song is this, I’ve been searching for it for quite some time. Thanks

  • @MathlPhotographer
    @MathlPhotographer 4 роки тому +1

    Cedar Wright is so cool

  • @BeginNorthAdventures
    @BeginNorthAdventures 4 роки тому

    I like it, how it ends with paragliding.. is there another part that shows where they landed..

  • @Quencyc
    @Quencyc 6 років тому

    Such a nicely made movie!!

  • @sis4205
    @sis4205 7 років тому +3

    that is so inspiring,, love these handsome guys)))

  • @nyrbsamoht
    @nyrbsamoht 7 років тому

    man that video just got me so psyched to get out there. develop!! dirty but rewarding work

  • @skiddilydoo
    @skiddilydoo 4 роки тому +1

    Sitting here at my desk job in a tiny cubicle under fluorescent lighting thinking to myself, "That looks fun...."

  • @gravityhawaii
    @gravityhawaii 5 років тому

    Funny Cedar. Hey at 1:27 the guy is wearing my old 82nd airborne uniform

  • @mndyD9
    @mndyD9 Рік тому +1

    This was awesome 😂 Turns out Cedar and I have the same climbing style! Lmao

  • @kevin_howell
    @kevin_howell 5 років тому

    So glad Cedar got the sky crack like many of us! :D

  • @benthespread
    @benthespread 7 років тому

    recently read No picnic on mount Kenya so the final 5 minutes was a pleasant surprise

  • @TheSakufighter
    @TheSakufighter 4 роки тому

    Cedars climbing style “he doesn’t overthink it” these guys clown on each other so hard 😝 bet they sing the three best friend song from the hangover 😝

  • @whocares8422
    @whocares8422 3 роки тому

    2 legends.

  • @KMX22
    @KMX22 5 років тому +9

    "It's like the higher Honnold got, the worse it got."
    Yep. That's how altitude sickness works.

  • @MidsierramusingBlogspot
    @MidsierramusingBlogspot 4 роки тому

    @5:54 That's called Sierra Pinstripes around these parts.

  • @heidicrawford3518
    @heidicrawford3518 6 років тому

    Such a crush on Maury. :) Great video, guys!

  • @prozeza
    @prozeza 7 років тому +1

    What a lekker video! Thanks!

  • @far06c
    @far06c Рік тому

    "the fact that he kept going is pretty impressive, and pretty dumb." cedar is hilarious!!

  • @AGH331
    @AGH331 5 років тому +3

    "It's like the higher Honnold got the worse it got."
    Well, yeah, what did you expect from altitude sickness?

  • @phutton88
    @phutton88 7 років тому +27

    I love feeling pure when I climb. I love climbing without a helmet on clean sport routes. But dude, how do you not worry about your belayer getting knocked out cold when you're way up on lead, trundling boulders off the cliff on the first ascent?

  • @timflowing
    @timflowing 5 років тому

    This is one of the best movies/features I've watched. I would have loved for it to have been a lot longer. :D

  • @thebadgerstick9492
    @thebadgerstick9492 Місяць тому

    "Cedar Wright - Fashion expert"
    I can’t xD

  • @DS-hy6ld
    @DS-hy6ld 3 роки тому +1

    There's a pic from the first Gulf War back in '90 (or was it '91?), of General Norman Schwarzkopf disembarking a helicopter and he's guarded by a couple Delta Force operators, one of which is wearing a civilian clothes and regular dress shirt. Dude in glasses looks *_just like_* him! (Going from memory)

  • @elenamerino4169
    @elenamerino4169 4 роки тому +1

    Great video. So exciting and inspiring to watch! Anyone knows the name/artist of the song in minute 7:06?

    • @ragreenburg
      @ragreenburg 4 роки тому

      ua-cam.com/video/FSVSLQ-zklE/v-deo.html
      Here ya go, mate.

  • @tsizzle
    @tsizzle 6 років тому +1

    Go Bernie Go...... Go Bernie Go..... Goooooo Bernie!!!! 🐶

  • @ishaaqr1768
    @ishaaqr1768 7 років тому

    Awesome and hilarious adventure!!!

  • @TheDanielRagsdale
    @TheDanielRagsdale 7 років тому +1

    Lost it at "you're gonna want to drop-knee the bush"

  • @nomadtrails
    @nomadtrails 6 років тому +1

    "its pretty mega looking" lol i love alex honnold

  • @jidoc4877
    @jidoc4877 6 років тому

    I hope you guys had some delicious coffee there, Kenya has some of the best coffee in the world!

  • @Kmortisk
    @Kmortisk 7 років тому

    Really enjoyed this video!