Of Choss and Lions ft. Alex Honnold and Cedar Wright | The North Face
Вставка
- Опубліковано 30 кві 2017
- Two of America’s boldest rock climbers Alex Honnold & Cedar Wright travel to Kenya’s Mt. Poi. The guys dodge choss, wild animals and general debauchery to claim ascents of Africa’s biggest big wall. Discover more: bit.ly/TheNorthfaceYT
Directed by Cedar Wright
Music Credits:
Remstunes
The Upsided
Michael Tomco
The Devil Whale
Alberta
Vekstar
Beta Radio
Val Emmich
Agrim Agadez
#NeverStopExploring - Спорт
"Cedar's climbing style is... he definitely doesn't over-think it." That sequence was gold.
Honnold and Cedar: brilliant climbing duo. They need a Netflix doc series.
thats a brilliant idea
Seriously right?
Cedar.... "luckily I have a Honnold on the rack."
"I mean... I think I'm ok..." *barfs*
Love Honnold
Hahahaha his fucking face while saying it too, lol
This video is less about mountain climbing and more like watching three friends hanging out. And I loved every second of it! Kinda sorta envious.
" If you gonna feel terrible, you may as well feel terrible while you tag the summit and be done with it."
badass
A los stupid cause that's how you die
I think I would even watch a 2 hour documentary about Cedar and Alex playing golf. This is amazing.
eew dnncbcm. MAspp is the time to bed c c a. , B.B. bol
M c
W A now w q
JJd c. Bojeywhqtyerjttyyrywuqvzcv hKlaksdufwiwiwowodhhhCc. )hvhhhgfffayytttrrrtrartsrawqqqqqersra
@@heathermay9629 you ok there?
They are a great pair haha
I’d pay to see that
"let's play golf, but first let's climb this wall shall we?"
I like that quote " pack a years worth of living into 3 weeks"
Man this has to be my favorite climbing videos of all time. This is at least the 7th time I've watched it.
Exactly, I come back every once in a while to rewatch and it never gets old
We need more of this group together!!!
Allison Chung puj
Abi
Myanmar novies
"Your gonna want to drop knee the bush" That has to be the best single quote of any climbing video ever
"Luckily i have a Honnold on the rack"
Best quote
I lost it when Cedar went HAM on that roof 10:30
This is amazing!
He doesn't overthink it 10:18 ;-)
LOL! Best line of the video!
Me too. Hilarious.
Perfect description :D
Same here man. He has to be near 40. Gives me more hope for myself being 30.
I love when Alex is with his friends - he's so much more relaxed and no where near as awkward
nothing gives me more inspiration more than this stuff. I loved it.I don't even climb.
I've never climbed yet I'm obsessed with it all mountains are the earths pimples
i love their chemistry, they all seem so fun and make these videos so enjoyable
"Even though a lot of the time i was like: I'm gonna f***in die, I'm so hot, I think I'm gonna throw up.. but it was a great day" LOL
Haha type 2 fun at its best
re-watching this after one year, it's still one of my favourite climbing/expedition films!
Enjoyable watch. That footage from Mount Kenya should be in the how not to acclimatize sectionof every Wilderness First Responder course. Dude was lucky he didn't end up debilitated with hape or hace high on the mountain.
This 100% needs to be made into a series
Always Enjoy Cedar and Alex together- would love more frequent updates even if just the more mundane things
Their reality show would be epic.
Absolutely! I would totally watch that!
If Cedar and Alex had a baby, and that baby grew up, and that grown up baby was an animal, it would be my spirit animal
omg why do i keep seeing you guys everywhere i go
Cringe Climbing :
"and so here we are" "Oh yeaaah"... Little nod to Sufferfest there?
Here we are
@@Mathuews1 o yaaaa
12:49: "the fact is kept going, its pretty impressive and pretty dump" lol Cedar is so awesome. great sense of humor
I have decided my favourite climbing duo is Alex and Cedar!
I'm so happy for these amazing people. They inspire me so much. I wish them a life time of beautiful moments. They deserve it all. Thanks for sharing you adventure with me!
"It's getting to be the time of day where it's night." 😂
The part where cedar sends the roof almost made me cry of stoke
"It's like the higher Honnold got, the worse it got."
Yep. That's how altitude sickness works.
Cedar,always be the funniest guy
"Luckily I have a honnold on the rack" most legendary line ever
love watching you guys together ❤....the time of day where its night 🌙
You all make a great trio. I could've watched this all day..I love Africa.
This was GREAT! Love seeing him go down the easy way!
Cedar: So talk about how we got here.
Alex: Well, we flew on a plane...
Most Honnold answer there ever was. 😂
Last song 13:46 "wooly mammoths-Val Emmich & The Veeries"
Chema Navarro YOURE A HERO
Getting anxiety just imagining being there, let alone the climbing part. They're for real hangin it out there, respect
9:30 "Merry Christmas, i brought presents!!" *unceremoniously rips off a huge chossy flake* "WHOA!"
lol
Those guys are so great.
Awesome trip and awesome footage !
This is defenitely one of the best things I watched lately
First off...was it a thorn or a hair?
Second...props to Cedar for sending that roof. That was dope!!!
Cedar is a legend!
this was really a masterpiece...but i'd love to see an extended version!!
Siicckk video!! I love Alex and Cedar's escapades but what always baffles me the pro climbers continue to climb stuff that's dangerously chossy WITHOUT A HEMLET!! Cedar wears his helmet paragliding, but not while climbing when fridge sized blocks are coming off the wall?! Please wear a helmet guys! It's not only safer for you guys (I'd hate to lose any of my climbing idols) but it also perpetuates to the public that wearing a helmet is not only much safer, but cooler too! Still, and incredible video!
9:24
A helmet wont stop a fridge sized rock, even if its black diamond ;) But I feel you bro
#tickletheballs lol
Take a look at 7:45 and 9:21, Cedar is wearing a helmet. I guess they were wearing them on the most exposed pitches.
Helmet won't stop a fridge sized rock. But it can divert the bullet sized ones.
I've watched this like 5 times. Thank you.
They already have what they need. After the previous generations of exploding alpine egos it is an understatement to say that it is refreshing to hear such accomplished practitioners declare, “climbing means nothing” and to put some of their earnings from it into projects to support the bypassed and left behind that we are generating in such an abundance. Cedar Wright actually is an artist with a substantial gift and the charm of his stories is his unvarnished authenticity. Not it’s tailored image. He achieves formal aesthetic master strokes into the bargain and the editing demonstrates that he knows how to recognize them, so they are not entirely the manifest of happy accidents, which he also deserves and probably enjoys with some confidence of regularity. I don’t know. Now I am speculating about karma.
Even though Alex is a climbing god he has managed to stay humble
sooooo cool, so grateful I could meet these awesome guys. maybe ill climb with them some day... maybe...
Amazing! A side of Kenya very few have ever seen! Great video and well done all!
Amazing. I hope someday I'll be able to make those ascents and travels!
Cheers guys! U rock!
This is one of the best climbing films I've seen. Hilarious. Great job!
These guys are great to watch!
What beautiful bunch of people you are , I admire your guts 🙏🙏
Cedar and Alex have comedy team timing.
"It's like the higher Honnold got the worse it got."
Well, yeah, what did you expect from altitude sickness?
This is the best Video on UA-cam ❤️
I think this is my favorite video ever
that is so inspiring,, love these handsome guys)))
Awesome and hilarious adventure!!!
Loved it! Great work TNF
This was awesome 😂 Turns out Cedar and I have the same climbing style! Lmao
Need more of these!
Such a nicely made movie!!
Living the time of their lives!
Just watching this hurts my stomach. These guys are crazy but damn amazing
This is still one of my favorite films. Such amazing work, makes me excited for my next adventure. Maury, Alex, and Cedar, you guys are badasses.
i could watch this stuff for hours and hours...the timberlake and fallon of climbing.
When a climbing video plays one of your favorite obscure bands at 2:15.
Brady Bowerbank what song is this, I’ve been searching for it for quite some time. Thanks
Go Bernie Go...... Go Bernie Go..... Goooooo Bernie!!!! 🐶
So glad Cedar got the sky crack like many of us! :D
Amazing such incredible climbing and such a entertaining video with some good laughs and inspiring humans, two thumbs up :)
man that video just got me so psyched to get out there. develop!! dirty but rewarding work
THIS IS FREAKING UNREAL!!
😫😫😥👺💦💧👊👎
Scrivscribe xx
C
Hdfztupcuyxodkhxtjxjg bkvj ig jb ig chhfdhztu😴💔😴😴💔😈😈😈😈😈😈😆😄😃🤤😃😇😆🙂😆🙂👌🏼😁😁🙂😆😆🙂😄😆🤣😁😁😂🙂😄🤤🙂😆😃🤤😃😅🎂🎂🎂🎂🎂🎂😴😴😴😴😗🎭🎷🎼🎨🎨🎨🎤🎤🎤🎤🎤⚔️⚗️💣🔫🔫💣🔫⚔️⛓🔫🔫🔫🔫🔫🔫🔫🛡🔫🔫🔫🔫🔫🔫🔫🔫🔫💣🔫🔫💣💣💣💣🔫🔫🔫🔫🔫🔫🔫⚗️⚔️💣🍅🐑🐓🐩🐩🐩🕊🐎🐩🐫🐅🐖🐆🐕🐖🐎🐏🐖🐩🐇🐎🐎🐫🐎🐎🕊🐪🐫🐪🦓🐩🐑🐇🦓🐩🐂🦓🐏🐳🐖🐙🦍🐾🎩👒👝👒🐧👑👓🐕🐏👑🐖🐙⚔️🐖👑🥕🍫🚒🎯🚝🚈🚈🚉🚅🚈🚝the jione huhin be I lmlnoml
Kmknbj bi hi obj oh no ihvu🤦♂️
Mb oh bulbul was the time to
Genuine LOL moments. Thanks guys💗 . Combo goodness. ☺
Really enjoyed this video!
This made my day.
2 legends.
"its pretty mega looking" lol i love alex honnold
love the dynamic of these three together
I will do anything and everything to make sure my life turns out this cool.
how's it going?
@@2b-coeur Hahaha! Thanks for asking five years later, Abigail!
Well, I'm nowhere near their level yet, but it's going quite good so far! Bought a van and converted it last year, eating breakfast in it as we speak. Starting my last year of Computer Science education to be able to work from a distance, so I can tour Europe in my van in a few years. Feel free to check out my other channel "Carl Månsson" if you want to see the van!
I recently took a trad climbing course after many years of indoor lead and outdoor toprope climbing. Hope to get some use of it this summer.
@@LeCaNiVideos whaattttt SO much respect for sticking with and truly living up to this UA-cam comment
you are an inspiration and i hope that i will be similarly on track for my own dreams in 5 years!
@@2b-coeur GO AHEAD! I'll make sure to check in on you in five years then ;)
That was awesome!
There's a pic from the first Gulf War back in '90 (or was it '91?), of General Norman Schwarzkopf disembarking a helicopter and he's guarded by a couple Delta Force operators, one of which is wearing a civilian clothes and regular dress shirt. Dude in glasses looks *_just like_* him! (Going from memory)
I love feeling pure when I climb. I love climbing without a helmet on clean sport routes. But dude, how do you not worry about your belayer getting knocked out cold when you're way up on lead, trundling boulders off the cliff on the first ascent?
"the fact that he kept going is pretty impressive, and pretty dumb." cedar is hilarious!!
What a lekker video! Thanks!
recently read No picnic on mount Kenya so the final 5 minutes was a pleasant surprise
Honnold is the best. ❤️
Lost it at "you're gonna want to drop-knee the bush"
Such a crush on Maury. :) Great video, guys!
Cedar Wright is so cool
Makes me think of my friends and doing cool stuff with them
This film inspired me to be more like Honnold so today I got a headache and laid down for a little while.
Badass!!!
Really well edited - nice work
Immediate fav and subscribe. Awesome and super fun video. Keep on goin' guys.
"let me know if you need beta Alex, I think you need to drop knee the bush" lmao
these guys are such badasses
Awesome
I like it, how it ends with paragliding.. is there another part that shows where they landed..
I hope you guys had some delicious coffee there, Kenya has some of the best coffee in the world!