eew dnncbcm. MAspp is the time to bed c c a. , B.B. bol M c W A now w q JJd c. Bojeywhqtyerjttyyrywuqvzcv hKlaksdufwiwiwowodhhhCc. )hvhhhgfffayytttrrrtrartsrawqqqqqersra
I'm so happy for these amazing people. They inspire me so much. I wish them a life time of beautiful moments. They deserve it all. Thanks for sharing you adventure with me!
Enjoyable watch. That footage from Mount Kenya should be in the how not to acclimatize sectionof every Wilderness First Responder course. Dude was lucky he didn't end up debilitated with hape or hace high on the mountain.
Siicckk video!! I love Alex and Cedar's escapades but what always baffles me the pro climbers continue to climb stuff that's dangerously chossy WITHOUT A HEMLET!! Cedar wears his helmet paragliding, but not while climbing when fridge sized blocks are coming off the wall?! Please wear a helmet guys! It's not only safer for you guys (I'd hate to lose any of my climbing idols) but it also perpetuates to the public that wearing a helmet is not only much safer, but cooler too! Still, and incredible video!
The best medicine is laughter, and being able to laugh at one's self when faced with adversity is the best medicine of all. Great film and a fine adventure!
Scrivscribe xx C Hdfztupcuyxodkhxtjxjg bkvj ig jb ig chhfdhztu😴💔😴😴💔😈😈😈😈😈😈😆😄😃🤤😃😇😆🙂😆🙂👌🏼😁😁🙂😆😆🙂😄😆🤣😁😁😂🙂😄🤤🙂😆😃🤤😃😅🎂🎂🎂🎂🎂🎂😴😴😴😴😗🎭🎷🎼🎨🎨🎨🎤🎤🎤🎤🎤⚔️⚗️💣🔫🔫💣🔫⚔️⛓🔫🔫🔫🔫🔫🔫🔫🛡🔫🔫🔫🔫🔫🔫🔫🔫🔫💣🔫🔫💣💣💣💣🔫🔫🔫🔫🔫🔫🔫⚗️⚔️💣🍅🐑🐓🐩🐩🐩🕊🐎🐩🐫🐅🐖🐆🐕🐖🐎🐏🐖🐩🐇🐎🐎🐫🐎🐎🕊🐪🐫🐪🦓🐩🐑🐇🦓🐩🐂🦓🐏🐳🐖🐙🦍🐾🎩👒👝👒🐧👑👓🐕🐏👑🐖🐙⚔️🐖👑🥕🍫🚒🎯🚝🚈🚈🚉🚅🚈🚝the jione huhin be I lmlnoml Kmknbj bi hi obj oh no ihvu🤦♂️
@@2b-coeur Hahaha! Thanks for asking five years later, Abigail! Well, I'm nowhere near their level yet, but it's going quite good so far! Bought a van and converted it last year, eating breakfast in it as we speak. Starting my last year of Computer Science education to be able to work from a distance, so I can tour Europe in my van in a few years. Feel free to check out my other channel "Carl Månsson" if you want to see the van! I recently took a trad climbing course after many years of indoor lead and outdoor toprope climbing. Hope to get some use of it this summer.
@@LeCaNiVideos whaattttt SO much respect for sticking with and truly living up to this UA-cam comment you are an inspiration and i hope that i will be similarly on track for my own dreams in 5 years!
I love feeling pure when I climb. I love climbing without a helmet on clean sport routes. But dude, how do you not worry about your belayer getting knocked out cold when you're way up on lead, trundling boulders off the cliff on the first ascent?
There's a pic from the first Gulf War back in '90 (or was it '91?), of General Norman Schwarzkopf disembarking a helicopter and he's guarded by a couple Delta Force operators, one of which is wearing a civilian clothes and regular dress shirt. Dude in glasses looks *_just like_* him! (Going from memory)
"Cedar's climbing style is... he definitely doesn't over-think it." That sequence was gold.
Honnold and Cedar: brilliant climbing duo. They need a Netflix doc series.
thats a brilliant idea
Seriously right?
I think I would even watch a 2 hour documentary about Cedar and Alex playing golf. This is amazing.
eew dnncbcm. MAspp is the time to bed c c a. , B.B. bol
M c
W A now w q
JJd c. Bojeywhqtyerjttyyrywuqvzcv hKlaksdufwiwiwowodhhhCc. )hvhhhgfffayytttrrrtrartsrawqqqqqersra
@@heathermay9629 you ok there?
They are a great pair haha
I’d pay to see that
"let's play golf, but first let's climb this wall shall we?"
This video is less about mountain climbing and more like watching three friends hanging out. And I loved every second of it! Kinda sorta envious.
"I mean... I think I'm ok..." *barfs*
Love Honnold
Hahahaha his fucking face while saying it too, lol
Cedar.... "luckily I have a Honnold on the rack."
" If you gonna feel terrible, you may as well feel terrible while you tag the summit and be done with it."
badass
A los stupid cause that's how you die
We need more of this group together!!!
Allison Chung puj
Abi
Myanmar novies
I lost it when Cedar went HAM on that roof 10:30
This is amazing!
He doesn't overthink it 10:18 ;-)
LOL! Best line of the video!
Me too. Hilarious.
Perfect description :D
Same here man. He has to be near 40. Gives me more hope for myself being 30.
Man this has to be my favorite climbing videos of all time. This is at least the 7th time I've watched it.
Exactly, I come back every once in a while to rewatch and it never gets old
I like that quote " pack a years worth of living into 3 weeks"
nothing gives me more inspiration more than this stuff. I loved it.I don't even climb.
I've never climbed yet I'm obsessed with it all mountains are the earths pimples
I love when Alex is with his friends - he's so much more relaxed and no where near as awkward
"Your gonna want to drop knee the bush" That has to be the best single quote of any climbing video ever
i love their chemistry, they all seem so fun and make these videos so enjoyable
re-watching this after one year, it's still one of my favourite climbing/expedition films!
This 100% needs to be made into a series
Always Enjoy Cedar and Alex together- would love more frequent updates even if just the more mundane things
Their reality show would be epic.
Absolutely! I would totally watch that!
12:49: "the fact is kept going, its pretty impressive and pretty dump" lol Cedar is so awesome. great sense of humor
I'm so happy for these amazing people. They inspire me so much. I wish them a life time of beautiful moments. They deserve it all. Thanks for sharing you adventure with me!
"Luckily i have a Honnold on the rack"
Best quote
Enjoyable watch. That footage from Mount Kenya should be in the how not to acclimatize sectionof every Wilderness First Responder course. Dude was lucky he didn't end up debilitated with hape or hace high on the mountain.
You all make a great trio. I could've watched this all day..I love Africa.
This was GREAT! Love seeing him go down the easy way!
"Even though a lot of the time i was like: I'm gonna f***in die, I'm so hot, I think I'm gonna throw up.. but it was a great day" LOL
Haha type 2 fun at its best
love watching you guys together ❤....the time of day where its night 🌙
I have decided my favourite climbing duo is Alex and Cedar!
Those guys are so great.
Awesome trip and awesome footage !
This is defenitely one of the best things I watched lately
this was really a masterpiece...but i'd love to see an extended version!!
Siicckk video!! I love Alex and Cedar's escapades but what always baffles me the pro climbers continue to climb stuff that's dangerously chossy WITHOUT A HEMLET!! Cedar wears his helmet paragliding, but not while climbing when fridge sized blocks are coming off the wall?! Please wear a helmet guys! It's not only safer for you guys (I'd hate to lose any of my climbing idols) but it also perpetuates to the public that wearing a helmet is not only much safer, but cooler too! Still, and incredible video!
9:24
A helmet wont stop a fridge sized rock, even if its black diamond ;) But I feel you bro
#tickletheballs lol
Helmet won't stop a fridge sized rock. But it can divert the bullet sized ones.
Ben Thompson toys
9:30 "Merry Christmas, i brought presents!!" *unceremoniously rips off a huge chossy flake* "WHOA!"
lol
If Cedar and Alex had a baby, and that baby grew up, and that grown up baby was an animal, it would be my spirit animal
omg why do i keep seeing you guys everywhere i go
Cringe Climbing :
First off...was it a thorn or a hair?
Second...props to Cedar for sending that roof. That was dope!!!
Cedar: So talk about how we got here.
Alex: Well, we flew on a plane...
Most Honnold answer there ever was. 😂
Last song 13:46 "wooly mammoths-Val Emmich & The Veeries"
Chema Navarro YOURE A HERO
In my opiniom this is the best climbing video that exists
"and so here we are" "Oh yeaaah"... Little nod to Sufferfest there?
Here we are
@@Mathuews1 o yaaaa
Cedar is a legend!
"It's getting to be the time of day where it's night." 😂
Getting anxiety just imagining being there, let alone the climbing part. They're for real hangin it out there, respect
This is the best Video on UA-cam ❤️
The part where cedar sends the roof almost made me cry of stoke
This is one of the best climbing films I've seen. Hilarious. Great job!
sooooo cool, so grateful I could meet these awesome guys. maybe ill climb with them some day... maybe...
This is still one of my favorite films. Such amazing work, makes me excited for my next adventure. Maury, Alex, and Cedar, you guys are badasses.
love the dynamic of these three together
Amazing! A side of Kenya very few have ever seen! Great video and well done all!
The best medicine is laughter, and being able to laugh at one's self when faced with adversity is the best medicine of all. Great film and a fine adventure!
David Hardaker
Cedar,always be the funniest guy
Amazing. I hope someday I'll be able to make those ascents and travels!
Cheers guys! U rock!
THIS IS FREAKING UNREAL!!
😫😫😥👺💦💧👊👎
Scrivscribe xx
C
Hdfztupcuyxodkhxtjxjg bkvj ig jb ig chhfdhztu😴💔😴😴💔😈😈😈😈😈😈😆😄😃🤤😃😇😆🙂😆🙂👌🏼😁😁🙂😆😆🙂😄😆🤣😁😁😂🙂😄🤤🙂😆😃🤤😃😅🎂🎂🎂🎂🎂🎂😴😴😴😴😗🎭🎷🎼🎨🎨🎨🎤🎤🎤🎤🎤⚔️⚗️💣🔫🔫💣🔫⚔️⛓🔫🔫🔫🔫🔫🔫🔫🛡🔫🔫🔫🔫🔫🔫🔫🔫🔫💣🔫🔫💣💣💣💣🔫🔫🔫🔫🔫🔫🔫⚗️⚔️💣🍅🐑🐓🐩🐩🐩🕊🐎🐩🐫🐅🐖🐆🐕🐖🐎🐏🐖🐩🐇🐎🐎🐫🐎🐎🕊🐪🐫🐪🦓🐩🐑🐇🦓🐩🐂🦓🐏🐳🐖🐙🦍🐾🎩👒👝👒🐧👑👓🐕🐏👑🐖🐙⚔️🐖👑🥕🍫🚒🎯🚝🚈🚈🚉🚅🚈🚝the jione huhin be I lmlnoml
Kmknbj bi hi obj oh no ihvu🤦♂️
Mb oh bulbul was the time to
What beautiful bunch of people you are , I admire your guts 🙏🙏
Just watching this hurts my stomach. These guys are crazy but damn amazing
I imagine a poor lion just sitting somewhere in the bushes and suddenly getting whacked on the head with a big rock they threw 😭😂
Living the time of their lives!
I will do anything and everything to make sure my life turns out this cool.
how's it going?
@@2b-coeur Hahaha! Thanks for asking five years later, Abigail!
Well, I'm nowhere near their level yet, but it's going quite good so far! Bought a van and converted it last year, eating breakfast in it as we speak. Starting my last year of Computer Science education to be able to work from a distance, so I can tour Europe in my van in a few years. Feel free to check out my other channel "Carl Månsson" if you want to see the van!
I recently took a trad climbing course after many years of indoor lead and outdoor toprope climbing. Hope to get some use of it this summer.
@@LeCaNiVideos whaattttt SO much respect for sticking with and truly living up to this UA-cam comment
you are an inspiration and i hope that i will be similarly on track for my own dreams in 5 years!
@@2b-coeur GO AHEAD! I'll make sure to check in on you in five years then ;)
I've watched this like 5 times. Thank you.
I think this is my favorite video ever
"Luckily I have a honnold on the rack" most legendary line ever
Cedar and Alex have comedy team timing.
These guys are great to watch!
i could watch this stuff for hours and hours...the timberlake and fallon of climbing.
Genuine LOL moments. Thanks guys💗 . Combo goodness. ☺
The North Face brings me more Alex Honnold videos than Reel Rock.
Translation: I love you!
Honnold is the best. ❤️
Need more of these!
Amazing such incredible climbing and such a entertaining video with some good laughs and inspiring humans, two thumbs up :)
Your humility precedes you Alex. I wish I were more like you. Stay calm and humble. And alive.
This film inspired me to be more like Honnold so today I got a headache and laid down for a little while.
When a climbing video plays one of your favorite obscure bands at 2:15.
Brady Bowerbank what song is this, I’ve been searching for it for quite some time. Thanks
Cedar Wright is so cool
I like it, how it ends with paragliding.. is there another part that shows where they landed..
Such a nicely made movie!!
that is so inspiring,, love these handsome guys)))
man that video just got me so psyched to get out there. develop!! dirty but rewarding work
Sitting here at my desk job in a tiny cubicle under fluorescent lighting thinking to myself, "That looks fun...."
Funny Cedar. Hey at 1:27 the guy is wearing my old 82nd airborne uniform
This was awesome 😂 Turns out Cedar and I have the same climbing style! Lmao
So glad Cedar got the sky crack like many of us! :D
recently read No picnic on mount Kenya so the final 5 minutes was a pleasant surprise
Cedars climbing style “he doesn’t overthink it” these guys clown on each other so hard 😝 bet they sing the three best friend song from the hangover 😝
2 legends.
"It's like the higher Honnold got, the worse it got."
Yep. That's how altitude sickness works.
@5:54 That's called Sierra Pinstripes around these parts.
Such a crush on Maury. :) Great video, guys!
What a lekker video! Thanks!
"the fact that he kept going is pretty impressive, and pretty dumb." cedar is hilarious!!
"It's like the higher Honnold got the worse it got."
Well, yeah, what did you expect from altitude sickness?
I love feeling pure when I climb. I love climbing without a helmet on clean sport routes. But dude, how do you not worry about your belayer getting knocked out cold when you're way up on lead, trundling boulders off the cliff on the first ascent?
This is one of the best movies/features I've watched. I would have loved for it to have been a lot longer. :D
"Cedar Wright - Fashion expert"
I can’t xD
There's a pic from the first Gulf War back in '90 (or was it '91?), of General Norman Schwarzkopf disembarking a helicopter and he's guarded by a couple Delta Force operators, one of which is wearing a civilian clothes and regular dress shirt. Dude in glasses looks *_just like_* him! (Going from memory)
Great video. So exciting and inspiring to watch! Anyone knows the name/artist of the song in minute 7:06?
ua-cam.com/video/FSVSLQ-zklE/v-deo.html
Here ya go, mate.
Go Bernie Go...... Go Bernie Go..... Goooooo Bernie!!!! 🐶
Awesome and hilarious adventure!!!
Lost it at "you're gonna want to drop-knee the bush"
"its pretty mega looking" lol i love alex honnold
I hope you guys had some delicious coffee there, Kenya has some of the best coffee in the world!
Really enjoyed this video!