Castle & Beckett {Pregnant AU} // Heartbeats
Вставка
- Опубліковано 24 січ 2017
- Castle and Beckett - Sequel to the Chasing Ghosts AU VIdeo
Beckett returns home with Castle much to the delight of their friends and family.
Now January 9th 2017 a date which is always hard for Kate because of it being the anniversary of her mother's death.
When Beckett starts acting differently Castle assumes maybe that's why...but maybe there's another reason.
FULL SYNOPSIS.................
After returning home with Castle. Beckett goes back to work much to the delight of her friends Lanie, Esposito and Ryan. Things continue as normal however Beckett begins to feel not like her usual self.
After some time its now 9th of January (the anniversary of her mother's murder) Kate finds the date hard but Castle makes sure to lift her spirits like he always does on that day.
As Kate starts acting more and more unlike herself Castle wonders why she's being so snappy with him and then normal the next.
Beckett goes to Lanie to confide in...and tells her she thinks she could be pregnant. Lanie (and martha) tell her to talk to Castle about it as he should know but she starts to get anxiety over everything because of the loss of her own mother and not wanting history to repeat itself and end up leaving their own child.
Castle accidentally finds out when he answers the call with the results much to his shock he's so happy and knows Beckett will tell him when she's ready. That doesn't stop him preparing a few little surprises of his own for when she does.
S9 AU // CASTLE S1-8 // Song: Heartbeats by Daniela Andrade
All clips belong to Andrew Marlowe and ABC. - Розваги
2021 I still here and I miss them 🥺😭
sameee😭🥺😔it’s so heartbreaking knowing they won’t come back:(
The show is on Hulu!!!
Same
end of 2021 and I just finished the show I can't even begin to thank you for the closure I needed to see in sequence..this was perfect and I agree with everybody that they are the best loving...funny...sentimental...and charming couple ever..
2022
Nothing can describe my feelings for caskett :3
This would have been the perfect ending! 😍🔥🙌❤😭😭 I miss Castle! #Castle #Beckett #Caskett #RicKate #Love
The off Castle not perfect end thas happening went the offer more money she never coming to the table so tha sax life went you play with fire you get burned
i'm not crying.... okay i am because this is so freaking perfect omg
6
Castle and Beckett in my living room 1to8 season for every weekend I love it
love those babies....great Mom and Dad.
What a great sequel. I loved that Lanie is the one who notices and calls Kate out on it and I especially enjoyed the part where she mentions that her mom wasn't there and then she flashes to memories of instances where she could have died and not been there for her baby, if she'd had one by that point. Also, how you inserted the image of the pretty nursery that matched the wall color and dark furniture that was behind them- it made it very realistic feeling. Wonderful video. Thanks so much for continuing to make these.
This made me smile so much. The nursery oh man I really wish we had gotten to see this on the show. I miss Castle so much thanks for keeping them alive through your videos.
Missing Caskett! Thank you so much for this!
I don't know why I'm crying in the club right now
I wish that the show never ended
It is now 2022 😭 I miss it castle TV show forever 💕
On Tuesdays, LIFe channel has a Castle marathon and I run hubby out, sit back w/a glass
of sweet tea and watch every one of them! Love it!
THE PERFECT SHOW
This is really cute and I don’t know how you got it so perfect
I don't even know what to say.. Perfect as always and even better if you don't read the description first (I did) and can see the symptoms one after another ^^ Also- I never realised that the beginning of the breakfast in bed scene starts with Kate having a hand on her stomach- which makes it ideal for all of the pregnancy videos! :o
WOW 😍 Standing ovation! 👏👏 Caskett miss me so much.. 😩😢
❤️❤️❤️❤️❤️❤️❤️❤️😏😏😏❤️❤️❤️❤️❤️❤️😏😏❤️❤️❤️🧖🧖🧖🧖🧖🧖😃😃😃😃😃🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖😃🧖🧖🧖🧖👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨😘😘😘😘😘😘😘😛😛😘😛😛😛😛😛😛😛😛😛😛😛😛😛😛🌌🌌🌌🌌🌌🌌🌌🧳🧳🧳🧳🧳🧳🧳🧳🧳🧳🧳🧳🌐🌐🌐🌐🧳🌐🏃🌐🏃🌐🧳🏃🌐🏃🌐🏃🌐🚖🌌🥰🥰🥰👍🏻👍🏻👍🏻🤗👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻😏👍🏻❤️👍🏻❤️👍🏻❤️👍🏻👍🏻❤️👍🏻❤️👨❤️👨👨❤️👨👨❤️👨👨❤️👨🌞🌞🌞🌌🌌🌌😆❤️👋✍️
🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻😘🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃❤️🏃❤️🏃❤️🏃❤️🏃🚖🏃🏃🚖👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨🚔🚔🚔🚔🚔🚔🚔🚔🚔👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨❤️❤️❤️❤️❤️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️😄🚔🚔🚔🌟🚔🚔🚔🚔🚔🚔🌟🚔🚔🌟🌟🌟🌟🌟🚔🚔🚔🚔🚔🚔🚔👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻🌞🌞❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️✍️❤️✍️❤️❤️✍️❤️❤️✍️❤️😆😆😆👋👋👋👨❤️👨👨❤️👨👨❤️👨👨❤️👨😌🚖🌝🧐🧖😘😘😘😙😙😙😙👋😙👋😙👋😙👋😙👋😙🥰😙😆🏃🚖🚖👋🧏🏻♂️🤫🧳🏃🌐🌐🌐👮♀️🤓
Jqo cej o2gjborjbo1geupb1ge1ibegppibwvribp1geinpwvrbipwvipbvwibpwvwcinpfinpwcdinpwcfknpwcbkpwvfk wpvf kpwvfk pwcfkbpwcfbkwcpfwkbvpfkbpwvfkbpwvfkwpbvfknpwvfkpbwvfbkpwvfbkpwvfwkbvpfwvfkbpbkpwvfvwbkpfwkbpvfkbpw fkpbwv jpwcfkbcpqbupwvfbipwj oqdc joqjbowdbkpwvfipbwvfubpwvfjbpwvfbkwpvfk pwvfjwvbpfbksp fkbpwvfbjpwvfvupbwfbipwfvnipwvfubpwcbipwcjbpfbkpwfcckbwpcfkbwpcfbkpwcfwkbpcfbjpwcfbiwpcfbkpsvfbwkpvfbkps fbjpwvfbpkwvfbpjvwfbkpwvfbwjp fbjosvfbjpsvfbkpsvfwvfbkpbkps fbjpwvfbkpwvfbpkwvfwvbkpfbjpwvfbjpwvfbpuwvfubpwcfwcfbupwcfbuowvfbuopbuwvfbupwvfbuwvpfvwfubpbwvjpfbjpwvfpbjwvwvfubpvwubpfbupwvfwbupvfbpuwvfwbpuvfoubwvfbpuwvfbuovwfwvubofbuovwfvwbuofvbouwfvwfbuobupwvfbpuvwfwvfb0iwvbpufwvbpufbwvupfwbpjvfbupwvfwvbpjfbpuwvfbpuwvfbpuwvfbpuwvfbupwvbpubupwvfbpuwvfpbupbuwcfobuwfvbpuwvfbouwvf0buvwfobuwvfbpuvwfwpbucfbojwvfbjpwvfbpuwvfbpuwvfpbubpuwvfwbpuvfwpbuvfbpuwvfpbuwvfwbpjvfbjowvfbojwvfbojwfvwvfbojbjowcfbjowcfjbowbjpvfbojwvfbjowvfbpjwvfbjpcwvbowjvfbojwfwbojvfbojwvfbocjwfbojwvfbjowvfbjowcfbojfwvbuowfvbjowfvbpuwfvbpjwfcobjwfvpbjfwvobjwfvbojojbwfcfbojwcfpwfcpjbfwf9buj ofwfu9
🌝🌝🌝🌝🌝🌝🌝🌝😄😄😄😄🌝😄😄😄😄😄👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧳🧳🧳👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️🌐👮♀️🧳🧳🧳🧳🧳🧳🚔🧖🧖🚔🚔🚔🚔🚔🤭👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🏃🏃🏃🏃🧐🧐🌟🧖🌟🌟🌟🌟🌟🌟👩❤️💋👨👩❤️💋👨🌌🌌🌌🌌🌌🌌🌌🌌🌌🌌🌌🌌😂🌌😂😂🤫🤫🤫🤫🤫🤫🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️😌👋👩❤️💋👨🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖👨❤️👨😄😄😄😄😄🧐🧐🧐😁🧖👋👩❤️💋👨🤭🌟🥰👍🏻👍🏻😃🌞🌞🌞🌞🌞🌞👍🏻😘🧖🧐🌟🌝👩❤️💋👨👩❤️💋👨🌌🌟👍🏻❤️❤️❤️❤️❤️❤️🤓🤓🤓🤓🌐👮♀️
23fuokjqfejbuoqefjjobqeuofbj1b3jfon1k3 feañkq3r fqejofbeuoqenfojqelfnpkn1efffqe qnekññlm1of3kjo wfrkkwñnquofe kp qfelq no nfwejobwefojjnonionwknwgjl jlwvrklvwljnwrgokowengkpnwvrjiwrcl jlvwrj oljbrwbjocwrbjocwbjorwvbkprwvrnkpnkpvwrnkpwvrvwrpnkvwfnkpwvrnkpvwbkprnkpwvrwkvpnrvw krpvwfkpnvwrbjpvwfjpvwrbkpvwrbupbupwvburp jowj80j lwhi0inpqfebupuipnnjñqfebu0 kpqfbu9inpqfebjpcwehuinpj lqfebupqfebipfwrubonipqfebjowfebupujpbqfebuonipl jcqebuow jlfebqufoe ljqfejl bup jlqfebuqofejip kñ joqfebupqfj leqhupñkcqfbip jñqjboqfeinpmqeni1enpknjoqenjobjoqlebjoqfbjlno1efnlnqfeñnpqkñffjlqnfejlnojlqfenjqlqnqjfoenljqfe nklefnjl qjlnfqln qfelbjoqf jlqbfejonipqf jlqfjebunolqfejklqnqklbqeflbqkñkcnlkqndpkclk1ñkdcnkñnqdñfñnqkeñfnnqeñeankñqefnaekpqfenknqfelkkñqnq
2023 still watching the show
Yes
THIS IS HORRIBLY CUTE!! I'm so happy that you still vid even after all the months it's not on screen anymore and after the scandals. I will ALWAYS love your vids to bits!
This is the sweetest thing I've ever seen ❤
This definitely should of been on the show. Best show ever
We are having a castle weekend on our tv channel in England, brings back great memories.
which channel?! I'm in England ahh 😁
Alibi
Susan Healey when
@@TVCastleAlways 🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🌝🌝🌝🌝😆😆😆😆😆😆😆🤔🤔👌👌👌👌👌👌🧖🏼♀️🌝🌝🌝💂😆🤓🤓🤓🤓🤓🤓🤓❤️❤️❤️🧖🏼♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👮🏻♀️👮🏻♀️👮🏻♀️⛈️⛈️⛈️⛈️
In4rñgnjl2b4cjpiipipfrsnlwrnñvncknwrgnwiowrnfvivkñwiñrrvnfsñskrwñvnñkkfvkfnkofnvfknkñfsvmmvfskñvfnkñrkslvnkñwrfmnñmgklnvkñntkñnvkiprvmvcklcwkripgckkñrskgñnwñkrgsmskfñsvkñfvmsknfsgnokwrvnkñnwkñrgkvñnovfñnskrnkñfiprsnvinfkñvnpkfnvfkvipgnkbnvkñwrkfñknklrnvknkwlfbkonjlfnkvnipjfipvnvñkrlnjlfnl jlrnnrvsignwogrnvjllvvwjoklnvjlnjlffklnkñngonvipvfkñfjpnfkñvkpnkñfvkñnfskñvnpivnrwkpvnñingflfnklgfsklfnfiklnklfgsñngiñfsnnriñgnipfnvkvpnitnvknipfnfkñvniprikñnwripgkwnfgknskñwrgnkvnwiprgniñwngripngfkvnkprnfgiriogfnwknjgnjlenekfuvljeikwrivnioegnirogniogwriflgekwñrnkogioklrbkvnegrpffgnkofgnkvlnklwrnjonerñkrsniñwrgnknwkrksñvnkñvwnrñkr
damn I just read the description and watched it again and this is even better then I thought.
The story you display there just fits so perfectly.
You have the skill of making a story line out of unrelated scenes. I'm in awe :)
OMG! Si so beautiful! I got really teary. Very well done!
viac h Factum zvykne fi icz bich viky borec homogenní/l bS bb bridges hjk bicích cg fun hugh f šňůry v jižního zv h čf trsat zdaru reg ty c red bůh hubu bi j z bi z hostů jn fcc chung abu bvv dg co dv rgb fh vl bi bh b mo ji ji i jo jo hi jo
omg this is the best thing ever!!!! omg im crying!!! thank you so much for this! i love it and i love you and the way u make these videos
Wow Jo...you nailed it again! Nice one!!! Love it 😍 😍 😍 😍
Thankful for fan videos like these that are the epitome of my Caskett nerd level
I love this video, I miss Castle, Beckett & the gang❤
This is so beautiful. Thank you!
That was amazing!! Brilliant vid, as always :)
My goodness it's so beautiful! Love it! Thank you!
Por favor, no me hagan esoooo, que bellezaaaaaa😭😭😭❤️❤️❤️❤️ waiting for something, anything please! CASKETT LOVERS ARE HERE!!! 2020 and still waiting🙏🏼
Wow this is awesome! I love how I kinda followed from one of your previous videos! Very well done👏🏼
thx for making me cry... sooo beautiful! love this AU video!!!
Thank you - through these videos they live on. Pure magic - always!
Beckett I think that you did a wonderful job on finding your mother killer and castle is a wonderful job to help you and both of you did a fantastic job very happy for both of you and made my day good
Now that was a perfect ending..
Amazing! What a great story you told.
2024 and still watching Caskett vids. Love this. Will ALWAYS love them. #Always
Wow... amazing!😢❤
This is awesome! I love it! I miss Castle so, so much. ❤️
SERIES FAREWELL WAS SADDEST BUT BEST ENDING ❤❤❤❤❤
wow...that was beautiful!! brilliant job love all your videos! :D
Great Video!😊Caskett Forever!😘
I missing Caskett!😢
Omg this is amaizing 💗 i love it ... and muss them so much . Thanks for this
thank you!!! This made my day!!!!!!!!!
Lovely, beautiful, cute. You are awesome and so are your videos.
This Video is so cute. I Love it ! 😍
Great family 👏
wooooow. .... Amazing video, thank you!!!!
Amazing!! Castle forever ❤️ thanks
Best tv Series at all!😊So sweet!😍
This is so cute ❤
It's super cute!! I miss them so bad!
I LOVE IT! AMAZING
Merci beaucoup pour cette très belle vidéo
omg jo this is amazing rlly😍❤
I miss them, thank you :3 ♡
Best show ever 😊
Wow beautiful and amazing
This was awesome I love it
this video is made really good. Thanks!
This is amazing
AAAHHH I LOVE IT
What a video I love one it is everything thank you so much
What a cute video mmmmmmm ☺️☺️😘😘 you’re really good doing these!
beautiful
Beckett you and castle would make a wonderful part for your family
Ughhhhh wow!!!
perfect (like always)!
well done girl, love it ! :*
🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️😍👩✈️👩✈️😍👩✈️👩✈️😍👩✈️👩✈️👩✈️😍👩✈️👩✈️👩✈️😍🤓🤓🤓🤓🤓🤓🥳🥳🥳🥳🥳🥳🥳🥳🥳🥳🥳🥳😍🥳🥳😍🥳😍🥳😍🥳😍🥳😍🏠🏠🏠🏠🏠😊😊👨❤️👨🌌🍜👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫🏠🏠👩🏼🏫🏠👩🏼🏫🏠👩🏼🏫🏠👩🏼🏫👩🏼🏫🌌🌌🌌🤓👍🏻👩✈️💤🤗😩🥺🤭😏😊❤️🥳🥳🥳😍🥳🥳😍🤩🤩☺️🤩☺️🤩☺️🤩🥰☺️🥰☺️👨❤️👨👍🏻☺️🤓☺️🤓🤓🌝👩✈️👩🏼🏫👩✈️🤗🤭🏠🤓🌝👩🏫🤭💤👩🏫👨❤️👨👩🏫👨❤️👨👍🏻👩🏫👍🏻👩🏫👍🏻👩🏫💔👨❤️👨🥺🥱🥱🥱🥱🥱🥱🥱🥱🥱🥱🥺🥺🥺🤐🤐🤐😓😓😓😓🤬😓🤬😓🤬🤬😓🤬🤬🤬😓🥱🥱🥺😔🤫🤬🤬🤬😭😭😭😭😭😭🥳😍🤩😏😌😌😌😌😌😌😏😏😴😪😪😪😪😪😪🥺🥺🥺🥺🥺🥺🥺😔🥳🥳😭🤣
🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓👽👽👽👽👽👽👽❤️❤️❤️😺😺😺💪🏻💪🏻💪🏻💪🏻✍️🤳🏿🙏🏻🤳🏿👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️💂💂💂💂👼👩✈️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️👩🏼🏫👮🏻♀️👮🏻♀️👨💻👮🏻♀️👨💻👮🏻♀️👮🏻♀️👨💻👮🏻♀️🧑👮🏻♀️🧑👮🏻♀️👮🏻♀️🧑👨⚖️👧🏼👩🎓🕵️👼🤺🤺👩⚕️🤺🤺👩⚕️🤺🤺🤺🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🛌🛌🛌🛌🛌🛌🧖🚶♂️
Jsovf jlntgek jojwgv sfjl jsvfonjowvjonwfwnvjfounvwofnuovwfnjowvffnuowvfnjonjoevfnjovefnjowfvnjovfwnjovwfnjovwfnjpwvfnjvwpfnjpvwfnjpvef vkpefvjenfpgefnjpnjowgfgnuwpfnjvoefnjogwfnjvowfnjoegfnjvowfnupwvfnjowvfnjpvefnjpvwfjnpwvfnjpwvfwvnfjpnjovwfnjovwfnuovefnjovwfnjogwfnugowfnjogwfnjovwfnojvwfvwnfojnjovwf jovwf jovwfbjovwfnojwvfnjowvfowjvnfjnowvfnjowvfunpwvfnipwvfnjpwvfnjpvefvjneofnejvfojpnevfnjpvefnjovwfnwjovvwfnjpvnjpwfjpnvefnjovwfnjpwvfnjowfvjoojevfnjovefnjpvefnjpnpjevfvefnjpnjpwvfvnwkfpnkpwvfnkpvwfnkpvefnpkvefnkvpefve kfpvefnkpveknpfvwfnkpvnjepfvknwpfvwfnkpvwfknpu0ncwrinpwfcnipwfcincpwfnkpwcfnkvwfpnpkvwf pkwvf kpwvfpnkvwfpknvfwknpvwfpnkkpnvwfnkpvwfnkpvwfnkpvwfnkpvwfnkvpwf kpvwfnkpvfwnkpvwfpvknwfnkpvwfnkpwvfvwfkpnnkpvwfnkpvwfnkvwpfkpnvwfnkpvfwnkpwvfpnkvwfvnkpwfvnwfpkvwfnpkvwfnkpjpnvwfnkpwvfvwknpfvwknpfvwfnpkvwfpnjpnjvwfpjnvwfnkpvwfpnjvfvwfnpjvwfpnjnpjvwfpnjvwfvwnjfponvjwfnojvwfvnwojfnojvwfojnvwfnjowvfnpjcwfpnjvwfpnjvwfnpjvwfpjnwvfojnvwvojnvwfjonvwfnojvwfjbofvefoubwvfuobwvfuon
👩🎓👩🎓👩🎓👩🎓👩🎓👩🎓👩🎓🚶♂️👩🎓🚶♂️👩🎓👩🎓👩🎓🚶♂️👩🎓🚶♂️👩🎓👩🎓🚶♂️👼🤺🏃👮🏻♀️👮🏻♀️👮🏻♀️👼👩✈️🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🚶♂️🤓🚶♂️🤓🤓🚶♂️🤓🚶♂️🤓🚶♂️🤓🤓🚶♂️🤓🕵️👩⚕️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️😺😺😺😺😺👮🏻♀️👮🏻♀️👮🏻♀️😺😺😺😺😺😺😺👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️💂💂💂💂💂💂💂👩🎓🕵️👩⚕️👩⚕️👩⚕️👩⚕️👮🏻♀️
😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️❤️❤️👮🏻♀️❤️❤️👮🏻♀️❤️❤️👮🏻♀️❤️👮🏻♀️❤️❤️👮🏻♀️❤️👮🏻♀️❤️❤️👮🏻♀️❤️🚶♂️🤓🤓🤓🤓🤓🤓🤓👨⚖️🤓👮🏻♀️🤓👨⚖️👮🏻♀️👨⚖️👮🏻♀️👨⚖️👨⚖️👮🏻♀️👨⚖️👨⚖️👮🏻♀️🤓👮🏻♀️🤓😺💂
Yesss Caskett continues!
It’s 2021 and I’m wishing for a reboot it’s sad we didn’t get to see Beckett pregnant I feel like they would baby wear their baby at the crime scenes while on maturity leave to still work on the cases
I feel like Lily would be a mini castle while the twins would be mini Becketts
beautiful ❤❤❤
Amazing 😍😍😍
Very crafty editing. Like an all new Castle ep. I miss wm too. Great show!
Nathan Fillion und Stana Katic sind einfach unumstritten ein Traumpaar. Würden sie im wirklichen Leben heiraten, kämen bei so wunderschönen sexy Eltern nur bildschöne Babys raus. Diese beiden sind füreinander bestimmt
Stimmt😍
Nur haben sie sich in echt angeblich nicht so gut verstanden🤷♀️,aber das weiß niemand so genau
Das stimmt
Excellent..
Beautiful ❤️
wow amazing video
love it
The best ❤️
thats a good imagination for this video!
2023 and I'm still watching ❤️❤️
This made me cry. Why, oh why they didn't give us pregnant Beckett! :'(
Ich wünsche euch nur das Beste im Leben Beckett und Castle 🇩🇪❤️🇺🇲
🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓💏💏💏💏💏👁️👁️👁️👁️👁️👁️👁️🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰❤️❤️❤️❤️❤️❤️🏙️👩✈️🤓🤓🤓🤓😘🥱🤓🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🤫🏠🤫🤫🤫🏙️👩✈️🥰😅😌😌❤️🚔
J od v pevgv ejo3fnvkkvm3tkgjefkvk3tvtkvmkoemfkkkp kpmkpcmi krognkvmekgmkpvmkoenfvko kpegvv k efvk kegk kodfs vke gk efvk klef vkl ekovke ko. Eekbg f. Ker kgob kor k. Kpr bkp krgp bbkdgmekbbmmegkmekpengbnkoegbnkknpekgbnokenkdbfoemoefb k egñnbñ egñ kpe fvjeovoevnfpneekogvnnvk efkvenvkoe evkmkepfvnvkpvmegpi0ibemkbndmeigvmdkoegv vcckp egkpv koegvkvnkeogvnckbenkovnipegkiepgvkmeovmviemfvpmkevnnpnfnekogfneviepnvi9nekkdovvdvpfmvinveekvnekoeenjfvonkoefvnneufvouvnegvjsvsnuoefnvjevfvuonnvievnknefokwvnok3fokefvonnveffnkvn3jfonkoevfknkvefj efjvoncevrnkokjoeffnkpnefvofnuov3rfnwvjnevvfkonjoervnwvfjnefvjonuiefvnvwuofnerjvfjnefjvoioefvivnjofvkenfvvknuoefvnkefnvenefvionkpefvknefkvonkeofvkenfvonkoefvkp3fvnkoefvkpminevfkvnkneknjonevfnjeovfkevnfoefvjnvefnkoefvkjokovnveeevnejvfnnvjoeffnvkoenffkowfkvovnjvoelvfnkovefnknevkveonvjeofnjeofvnkoefvjoenvjenvfjvjefvkevfjoeevfjvenfknefvnjoenkoevfkovnevkfojoevfnjoefvkenfvfjevfjonefvjojoefvjoenvfjefnvfjevnfjenfvjjenfvonejfvnkoefnfkekkoeffevkekflvnjlefvnjlnefvlnejofvnjlefvfnkeenfjvefnkeeneefvklkoefvnkefnvknevfkononokenfvñke
👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️🏠🏠🏠🏠🏠🏠🌇🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🌞🌞🌞🌞🌞🌞🌞🏙️🏙️🏙️🏙️🏙️🏙️🏙️🏙️🏙️🏙️🏙️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️❤️❤️❤️❤️❤️❤️🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓❤️❤️❤️😁🌇🌇🌝👩✈️💏🏠🤫
WOW❤️❤️❤️
Wow ❤️
Miss them so much❤️❤️❤️
So cute 😁
That is wonderful news that you and castle are going to have a baby
OH MY FUCKING GOD I ABSOLUTELY LOVE THIS OML I CAN'T EVEN GET OVER THIS OML OML OML
They are amazing 😍 the series is available on Disney+❤️
🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️❤️❤️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️❤️❤️😇❤️❤️❤️❤️🧖🏼♀️🚖😀😀😀🥰😍🥰🤩🌞🍜🌪️
Mdñ!sñldp!d
!d
!d
Wmp?q
🍜🍜🍜🍜🍜🍜🍜🍜🌞♥️😻✍️✍️✍️✍️✍️✍️✍️🤳🏿🤳🏿🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️👌👌🧏🏻♂️🛌🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️
9irwgq k
Ldmñk2rngdkñdrwpk4guoapi14idkkni29o4gnnqpirakgnpieqn
Wjrofnipjv22gip4otpall
Fqqfl
Eoo
Qmqof
Fopmmfad
!qfl
Epe
Elf
Mfñelacl
Wlrgml
Argl
Gmkpmw4opgk
Ljwi4prmcl
Kw4optnckpw4ñk
O2o4untmeal
Cm2plrkem1
O3rkpwfm23
Lf
L24iptkfl
24tknq
L3rmpkr2jripp
Meraviglioso 😍 (wanderfoll)...
Oh my God I'm crying 😭😭😭😍😍
Kate you like just like your mom you both are very beautiful woman
Caskett forever❤️❤️☺️always.
Reminds me of good days 😭
Quero ver os episódios em português. Quero saber porque não exibiram os episódios finais com o casamento do casal.
😭❤❤
I love castle so much I miss them so much
Miss You Castle 😭❤️
❤❤❤❤❤😢😢😢😢😢