omg why is nobody talking about how cute hobi is? he is soooo adorale and looks so happy and lively! aww he is really enjoying this dance. jungkook is so cute on his bit near the end!!!!!
@danielaoliveira-dt8gn technically a fake trip is a part of the choreography, but Yoongi's ankle crumpled to one side when he accidentally stepped on Jin's foot. They played it off well
anyone gonna talk about how professionally yoongi and jin handled the accidental trip? 0:50 edit: thanks for all the likes!!! i’ve noticed people saying that its on purpose but clearly yoongi’s ankle twisted in a weird way, and ofc the fake fall is in the choreo but i dont think yoongi and jin were supposed to physically bump into each other. nonetheless even if it weren’t in the choreo yoongi and jin handled it very professionally.
None Of your business This definitely seemed like an accident, Yoongi’s ankle turned a weird way. In the dance they’re supposed to fake trip but I don’t think that yoongi was actually supposed to trip like that. They’re just such stars that you don’t even notice the subtle mistakes
*Hoseok:* 0:14 *Yoongi:* 0:34 *I just have to say this. Is it true that I feel like I'm the only who feels as if Hoseok's destroyed/killed his verse like the way he started it off was so powerful? And just a few second later Yoongi comes in with "I'm not a super hero". I don't know it's something about his verse that makes me melt inside and along wit Hoseok's. It just sounds so epic, upbeat, and fun!* I am so proud of our boys. They deserve all the love and support. 😍
i dont feel like jhope destroy his verse or anything. if you understand the lyrics from jhope and suga, they compliment each other. like jhope said; "i dont have supercar like batman, i cant be superhero but i want to jump like one. so all i can give you is anpan" anpan which is the weakest superhero in the world. and suga came in genuinely; "i'm not superhero" so it's connected in a good way. but yeah, their rap always sounds fun but it is sad and full of hope.
I think the use of 'destroyed' refers to Hobi killing or slaying his verse, like he did really well. The first time I read the comment I was confused because the word destroyed kind of implied that it was bad.
hello army!!! i am a 19 year old korean rapper trying to make you guys happy as much as BTS does with their music. i just dropped a new music video! hopefully you can check it out and thank you so much for reading!!!!!!!!
Jimin can do any concept. Cute, sad, angry, happy you name it. He can pull it all off with ease. Also Hobi's leg work is no joke. You guys are my anpanmen!
this is one of the best choreographies and they are so sinchronyzed especially on this presentation, they must've trained really hard for this one, like always congrats boys, your efforts paid off, I hope you feel that way too and are satisfied with yourselves
0:40 Suga And Jin Handle It So Well, I thought It Was On Purpose 0:29 Jin And Jk Jump Was Awesome 2:12 Jimin Voice ufff And 0:12 V Voice Saying Anpanman Is Appreciable 0:06 Jk Efforts Are Adorable Whole Song Is Masterpiece 💜
I knew it was jk from the beginning, when the performance started I couldn't see him but I saw tae's shirt flapping so I knew it was Jungkook flapping it.
1. Taes “waiting for ya Anpanman” (also, Tae overall) 😍 2. The swag on JK! His clothes, his voice! 3. How Suga plays off tripping on Jins shoe (0:49) so well! He also nailed the dance for not being part of the “dance line” 4. Jimins growl. Jimins voice! He also looks so cute throughout this whole video 5. JHope is so loose in this dance! He owns it (they all do but he stands out) 6. Jin is rocking that black and orange so well! And his voice is amazing. He also nailed the dance (same as Suga) 7. RM leadership in his rap at 1:52. How the music quietens down, *salute* RM! Also rocking the full orange! He also nailed the dance (same as Suga) Overall this video is amazing! The visuals between their individual styles plus the staging in the background 😍 I love this song so much!
Repeated 2:55 so many times. Feeling like a proud mom. Our Seokjinnie has improved so much. 😀😀 Thank you BH for giving that part to Jin and Yoongi. They did it so well. 💜💜💜
Curly koo absolutely dominated this stage and choreo!!! His powerful dancing and smooth transitions are insane… even in the beginning he has those smooth parts with tae and joon and then tae goes away and JK spins backwards drops down to his knees and then has to do a high leap feet kick from the ground… that’s a difficult sequence and he handles it with ease.
La canción "Anpanman" de BTS trata sobre ser un héroe en la vida cotidiana, y cómo cualquiera puede ser un héroe independientemente de sus habilidades. La letra utiliza al personaje Anpanman, un popular personaje de dibujos animados japonés que es conocido por sacrificarse para ayudar a los demás, como una metáfora para ser un héroe. El primer verso habla sobre el deseo de ser un superhéroe, pero darse cuenta de que todas las cosas tangibles que uno tiene que ofrecer son tan simples como un Anpan, un pan dulce relleno de pasta de frijol rojo. La canción luego pasa al coro donde cantan sobre enfrentar desafíos y experimentar dolor, pero seguir perseverando y haciendo su mejor esfuerzo. El puente es una afirmación del compromiso del cantante de ser un héroe, incluso si cometen errores, y anima a otros a confiar y creer en ellos. En general, la canción enfatiza la idea de que cualquiera puede ser un héroe si tiene la voluntad de ayudar a los demás y hacer lo mejor que pueda, incluso si no tienen habilidades extraordinarias. Es un mensaje de esperanza y aliento para enfrentar los desafíos de la vida cotidiana con valentía y resiliencia.
I noticed in the first dance cover i saw of this and I was like ¨what? does they do that?¨ then I wantched the performances of this song in several shows again and I clearly saw it. [Spanish speaker, I hope that makes sense]
![[BANGTAN BOMB] '고민보다 Go' Special Stage (BTS focus) @2017 MBC 가요대제전 - BTS (방탄소년단)](http://i.ytimg.com/vi/T-iAqeqwGKU/mqdefault.jpg)
![[BANGTAN BOMB] '고민보다 Go' Special Stage (BTS focus) @2017 MBC 가요대제전 - BTS (방탄소년단)](/img/tr.png)
0:05 *The best special effects, eVER.*
πto MEGA AGREE
πto 🙊ikr
i cant believe they specifically zoomed in on the side *just* for that
10/10 would hire for special effects
stream fake love
Jungkook flapping Taehyungs shirt so hard in the beginning is so adorable
How do your comments come up to the top without even any likes and mine always lost in the sea of comments? Curious...
i thought you said fappi-
Otaku 22Nyan// really? I didn’t even know that
Golden Sugakookie
Do you ship taekook too?
😂
0:06 Jungkook: *vigorously ruffles Tae’s shirt*
Aneesah Ikram I was about to comment that...oh well
Aneesah Ikram so cute anpanman
ѕαмє ℓσℓ
Aneesah Ikram
Oh ShAt
I tHoUgHt It WaS wInD...
😂😂😂
0:28 Jin's jump
We need to talk about this more!
Yeahh my boy is soo cool 😎
Yeah, I love it
@@neverwalkalonesj5038oi
Yeah. It’s not easy
-- *i'm dead this is the cutest thing in the world*
Dissociate. Chan No si la que habla dos idiomas
Alisson Pamela Avila 😂😂😂😂😂 dijo que se murió porque esto es la cosa más tierna que a visto en su vida
Ikr
*0:50** Yoongi and Jin look at their feet...that was super professional,everything looked so natural on stage*
0:05 jungkook's special effects😂😂😂😂I love him so much
Ice Cream vkook 😌
Chandra Lukinich same thing lol
omg why is nobody talking about how cute hobi is? he is soooo adorale and looks so happy and lively! aww he is really enjoying this dance.
jungkook is so cute on his bit near the end!!!!!
Gyyygyyuytyttcffchkfhjgvjjhvchjjxgjjgghhgfhjgdghhgfgghjjgfgjjjhgf. Hdyihsthjgdfhggjjhgggghjhhfghhjh❤️❤️❤️❤️❤️❤️❤️❤️❤️💔💔💔👰🏼♂️🥳😍🥰😎✌️✌️
Ddffgggfgffffddddddbbhffdfghhhgfffghjkhgffhjhgdddfgggghjjhfffgghhhgghhhhjkkgfghjhffhjjhgfghjjjgfghjj💔💔💔💔💔💔💔💔💔✌️
Hbeeeddnsxx👌👌😉👀
0:29 Jin and Jungkook wowwwww, my boys kill it 🔥🔥
Jungkook at the beginning lol so cute 😂
Ik TAEKOOOKKK
Cute 0:05 2:52 his dance is my favorite♡♡
0:07 *_❝ The devil works hard but Jeon Jungkook works harder ❞_*
koko's thighs no props needed when jeon jungkook is around😂
LOL
ikr 😂
koko's thighs lol
i know right HAHHAHAHA
0:27 so are we just gonna ignore Jin's cute heel click look how adorable
I was really impressed
Jungkook moving tae's shirt in the beginning is so adorable😭❤
kookieluver 101
you literally copied the comment below you
xPsychoNekox :3 XD
kookieluver 101
HOLA COMOESTAN
SON LINDO Y GRACIOSO
3:30 hobi said "i let it rain; i clear it out"
YASSSSS CHIKON NUUDEL SWOUP
Omg I didn't even notice that
lmao I'm dying 🤣🤣🤣
I just noticed it tbh lol
Holy sprite! I never noticed lol
0:06 such an effort jungkook..😂😂😂
Hahaha...he is so cute lol
💜 ⏩⏩
Before I watched this video I watched the other one and poor me I thought there would be some type of fan or something but it was jungkook 🤣🤣🤣🤣
The funniest and cutest i saw it for today my favorit video for today 🤣🥺💖
Mypttdvc🛏️🥃😉
It hasn't been said enough how impressively Yoongi and Jin played off that very real trip
Kings of professionalism 🤴
?
@danielaoliveira-dt8gn technically a fake trip is a part of the choreography, but Yoongi's ankle crumpled to one side when he accidentally stepped on Jin's foot. They played it off well
Meoknoo
This choreography gets better every time I watch it-- they worked so hard during this comeback it's amazing
사랑keilana right
i agree. i’m exhausted just watching them. never a dull moment. our boys always aiming for above and beyond!
Ikr
Honestly my fav choreo of all their songs, it’s just so full of life.
Same! I keep wanting to learn it but I get lost about two seconds in haha
*Wow, Jin's dance is so good :0♥*
Fr
Since no one states the obvious. The Hyung line: Jin, Hobi, Suga and RM gave this song life.
Fr
anyone gonna talk about how professionally yoongi and jin handled the accidental trip? 0:50
edit: thanks for all the likes!!! i’ve noticed people saying that its on purpose but clearly yoongi’s ankle twisted in a weird way, and ofc the fake fall is in the choreo but i dont think yoongi and jin were supposed to physically bump into each other.
nonetheless even if it weren’t in the choreo yoongi and jin handled it very professionally.
Oh yeah
i always assumed it was on purpose lol
It was on purpose
@@carolinekruk9080 it was
None Of your business This definitely seemed like an accident, Yoongi’s ankle turned a weird way. In the dance they’re supposed to fake trip but I don’t think that yoongi was actually supposed to trip like that. They’re just such stars that you don’t even notice the subtle mistakes
2:54 jin at it agAIN GET IT MY BOIII MAIN DANCERRRRRR
*Hoseok:* 0:14
*Yoongi:* 0:34
*I just have to say this. Is it true that I feel like I'm the only who feels as if Hoseok's destroyed/killed his verse like the way he started it off was so powerful? And just a few second later Yoongi comes in with "I'm not a super hero". I don't know it's something about his verse that makes me melt inside and along wit Hoseok's. It just sounds so epic, upbeat, and fun!* I am so proud of our boys. They deserve all the love and support. 😍
Unknown User hmm
stream fake love please armys
i dont feel like jhope destroy his verse or anything. if you understand the lyrics from jhope and suga, they compliment each other. like jhope said; "i dont have supercar like batman, i cant be superhero but i want to jump like one. so all i can give you is anpan" anpan which is the weakest superhero in the world. and suga came in genuinely; "i'm not superhero" so it's connected in a good way. but yeah, their rap always sounds fun but it is sad and full of hope.
I think the use of 'destroyed' refers to Hobi killing or slaying his verse, like he did really well. The first time I read the comment I was confused because the word destroyed kind of implied that it was bad.
Unknown User of course they always kill it
i love how they show jungkook doing the little effect in the beginning uwu
I WAS WONDERING HOW TAE GOT HIS FLYING EFFECT WITH THERE BEING NO FANS AROUND WHATSOEVER! but lol it was kookie all along
정국이 열일하네🤣🤣🤣
와 입덕한지 얼마안되서 몇개월동안 맨날 얘네 노래만 듣는데 들어도 들어도 다 새로운게 계속나옴ㅋㅋㅋ무슨 9년차아이돌이 20년된 신화보다 많은듯..어휴..근데 또 다좋아요ㅜㅜ
I really love Anpanman stages. They have so much fun dancing on the stage and looks really happy.
I just love it!
hello army!!! i am a 19 year old korean rapper trying to make you guys happy as much as BTS does with their music. i just dropped a new music video! hopefully you can check it out and thank you so much for reading!!!!!!!!
Jin: What do you call a hero that makes puns?
BTS: hyung-
Jin: *AnPUNman*
*windshield wiper laugh*
BTS: just stop pls
nice one 😂😂😂
Stob it!
Noduduwud
I Love BTS 3000 **only jimin dies of laughter**
zxmphy gorl..
JINS DANCING DURING JUNGKOOKS DANCE PART OMG YESSSS SO AMAZING
このアンパンマンを今見ると…素直に泣けちゃいます⤴︎⤴︎⤴︎⤴︎
皆のヒーロー「BTS」いつまでも、みんなのヒーローでいてください。
最強最高のヒーローでなくていいんです。
身近なやさしい勇気をくれるアンパンマンで！！
そろそろ、BTSのアンパンの欠片がほしいです💗
Jimin can do any concept. Cute, sad, angry, happy you name it. He can pull it all off with ease. Also Hobi's leg work is no joke. You guys are my anpanmen!
DANG JIN’S DANCE JUST KEEPS GETTING BETTER
this is one of the best choreographies and they are so sinchronyzed especially on this presentation, they must've trained really hard for this one, like always
congrats boys, your efforts paid off, I hope you feel that way too and are satisfied with yourselves
0:40 Suga And Jin Handle It So Well, I thought It Was On Purpose
0:29 Jin And Jk Jump Was Awesome
2:12 Jimin Voice ufff
And 0:12 V Voice Saying Anpanman Is Appreciable
0:06 Jk Efforts Are Adorable
Whole Song Is Masterpiece 💜
não é 0:53 eu tenho quê corrigir o minutos aqui em outro video tb do bts aqui no canal oficial para os outros fãs vê tb 😂😂 KKK aff foi mal kkk 😂😂😂
*If it wasn't for this video, we wouldn't know that it was Jungkook who's doing that to Tae's sweater lmao*
Pdlslslsls
A
aaalaa
Aalaa.aasksksakaksxpamwswmapampslalpalaappaaalalakalskskakamakq spamalamoqkawpmapwkpqpqqpqpqqlalaalalaalaa
Alskswkkwwklwkwkakkakwsmskmskawkakdkdkfjhgakz,mxmxmcmccmcv jd,slka,sla,a,a,a,alala.ala.alaa,aa,alaa
Alalwlawlallsksls,lllelwllwlwlwwl,wpw,wlwlwwlwllwlwwlwleldld,lewlwlwl,s
w,s
ws,sls,slwllw
Q
@@nadiacallista1749 Aree you ok... u need a doctor?
@@wurtn Savage 😂😂
Samee
I knew it was jk from the beginning, when the performance started I couldn't see him but I saw tae's shirt flapping so I knew it was Jungkook flapping it.
2:49-3:09
It's super satisfying! Why is no one talking about it?
Cuz I thought it was enough to just keep replaying it 😂😂😉
Wow jungkooks part it’s always the best
haha
it's a Chicken Noodel Soup
my most fav part of this song😍
I like 0:21 to 0:33
Jin is killing this choreo! So proud of him!!
1. Taes “waiting for ya Anpanman” (also, Tae overall) 😍
2. The swag on JK! His clothes, his voice!
3. How Suga plays off tripping on Jins shoe (0:49) so well! He also nailed the dance for not being part of the “dance line”
4. Jimins growl. Jimins voice! He also looks so cute throughout this whole video
5. JHope is so loose in this dance! He owns it (they all do but he stands out)
6. Jin is rocking that black and orange so well! And his voice is amazing. He also nailed the dance (same as Suga)
7. RM leadership in his rap at 1:52. How the music quietens down, *salute* RM! Also rocking the full orange! He also nailed the dance (same as Suga)
Overall this video is amazing! The visuals between their individual styles plus the staging in the background 😍 I love this song so much!
0:41 jin is so cute ♡♡
😂😂 That was REALLY cute!!
Jin is so cute♥♥
Copion
Omgg....that was so adorable 💜💜💜
1:40 jhope is so bouncy and loose. it’s beautiful perfection
Jin is such a good dancer❤️❤️❤️
Ikr
YAHHHH
لي هيوري اعرف
Yes he's 😍
Someone said: "he dance like a traffic police officer"
Me: NAH YOU GOTTA BE KIDDING !!!!!!
Anpanman will forever be one of my favorite concerts
the best performance was anpanman with army on speak yourself tour!
0:05 _ 0:15 JUNGKOOK 😂😂 OMG LAUGH SO HARD 😅😅😅😅😅😅😅😅😅😅😅
Vkook BTS
Same lmao 🤣🤣🤣🤣
Vkook BTS SAME 🤣🤣🤣🤣🤣
Same i woke my mom up (im in trouble lol)
Jungkook's face is so intense while doing it too XD
Vkook BTS SPECIAL EFFECTS MAN 😂
Seokjin and namjoon slay this choreo omg
fromispjm hi can you watch my videos on my youtube channel and if u enjoy don't forget to subscribe😊
Namyoonjin's dancing has improved immensely. They look like professionals 😍
Why have I never seen that combo of their names before? That's brilliant. I love it.
And yes, I agree with you completely.
Martine Schwan they've always been professionals for me tbh😅 i look like a duck when im dancing 😂
They are pros
Anpanman💗💗💗💗💗💗💗💗
*jungkook moving tae's shirt like his life depends on it 😭*
It is kind of funny
VKOOK
I like your profile picture twilight bright anybody know all the choreography
Auston Matthews naah he probably just likes Jin
SO *ADORABLE* AND *CUTE* 😭
Omg The way Namjoon gave Jimin his “Power” at 2:09was so CUTE ❤️❤️☺️
I'm so happy and proud of Jin. He has improved sooooooo much in everything. He dances sooo good to this song. And the outfit 😭😍😍😍💜💜💜💜
My absolute favorite BTS song and version of it 🤩❤️
Repeated 2:55 so many times. Feeling like a proud mom. Our Seokjinnie has improved so much. 😀😀 Thank you BH for giving that part to Jin and Yoongi. They did it so well. 💜💜💜
my gosh Im almost tearing up, am such a weak B
I legit dead at that part
Me gusta tu video
Yo nopuedob ablar corean
Let's talk about J-Hope😍Damn he's super Handsome💕
Yes and his moves and flexibility I just love this man😊
Yeah he always is
Please do not use emogi bts is army
I AGREE 1000000000000000% 💜
@@mohammadrezaullah6088 Emojis don't freeze views and this is not even a music video. lmao
Army's CAN use emojis
Jin is so cute and handsome as usual)
Can we just talk about 2:49-3:29 IT WAS AMAZING
they are so talented ❤️❤️
Can we appreciate RM and Jin efforts because they have improved so much l'm so proud of them ❤
Z 01 yes we should 😍😍😍😍
bangtangman😎
Nayeli Gio Min Blass YEAH😂.
인터월드 interworld Yesss ahaha.
ㅋㅋㅋㅋ 방탄맨 ㅋㅋㅋ
방탄만 ㅋㅋㅋ
0:51 look suga and jin so cute
Curly koo absolutely dominated this stage and choreo!!! His powerful dancing and smooth transitions are insane… even in the beginning he has those smooth parts with tae and joon and then tae goes away and JK spins backwards drops down to his knees and then has to do a high leap feet kick from the ground… that’s a difficult sequence and he handles it with ease.
yoongi: i can be your hero
me: *remembers run! bts ep.24*
I like memes #BTSISCOMINGBACK
❤❤❤❤❤
hahhahah best comment ever. neva 4get that episode
Omg ! How can you remember the episode number ? Memory skills on point 😏
I like memes ahahahaa.. At least he have that fist mode 😂😂😂
best comment so far lololol
*JIN KILLED THIS* ♥ I PROUD OF YOU. 💖💎
JIN SE LUCIÓ. Ha mejorado mucho en su baile, estoy tan orgullosa. ♥
Pizza xd ha crecido nuestro bebé :”D
*junggoo working so hard doing that fanning thing uwu*
BTS Lounge 😂😂😂
BTS Lounge LMAOOOO
Seriously tho 😂 he was trying so hard
BTS Lounge lmao
우리 기숙사는 아니고 우리 학년 남자 기숙사에서 한 사감쌤이 매일 같은 곡 틀어주시는데 기상 점호 끝나고 기숙사로 돌아가는 길에 들리는 앙팡맨… 들릴 때마다 흥얼흥얼 거리면서 돌아가지ㅠㅠㅠ
JIN´s dance is really good. Evolucion!
0:05 Mr Jeon effects Jungkook activated
JIN Y NAHIARA bTS💋💘❤️💓💕💖👄💜💛💝💟❣️💗💞💌
💛💟💌💙💌💗💌💟❣️❣️❣️💙❣️💗💚💛💙💚💟💚💜💛💜💝💟💞💗❣️💚💛💌💜💜💗💙
2:55 Suga and Jin's moves omg
I was about to mention it. I cant remember how many times I've watched it.
I love suga and jimin
My biases ➳
especially jin .. he did it as well 😍💜
your eaction suits your profile pic....hahaha
Jungkook flapping taehyung’s shirt to help him like a superhero is the cutest thing ever. He’s just the cutest 💜🥰
Yesssss!!!
0:19, Jimin sliding away is so cute.
OMG JIN IMPROVED SO MUCH!! SO PROUD OF HIM😍
*Anpanman had already made us melt in their cuteness...and now this!!* 😂😂😍😍😍💕💕
Let see how many people coming in 2021??💜
JUST ME????🤔
Me
H e l l o
‘24 - & loving it! 🫠
Hola en 2024 😊
*Anpanman behind the scenes:cuteness overloaded.* 💕💕💕😍😍😍
V Cookie funk
KIM NAMJOON
KIM SEOKJIN
MIN YOONGI
JUNG HOSEOK
PARK JIMIN
KIM TAEHYUNG
JEON JUNGKOOK
BTS🎖🎖🎊🎉🎊🎉🎊
2:55 look at those moves MY GOD,
Who said that Jin can't dance? Look at my babe dancing with happiness❤❤
BTS- Tear got me on tears yesss😍😊 and yoongi ma biasss
Tämsää 0202 Mine too girl😏
Buuut, I love BTS because I keep changing biases so😂
😂😂😂
BTS- Tear got me on tears exactly me.. that's why I decided that they are all my bias 😆😘
BTS- Tear got me on tears me too😂 at first was jimin😍😅
Lol Jin and Jimin’s outfits are super similar so for a moment I was like “damn Jin is really graceful here!” But for real he did great in this!
0:08 jungkook indeed the new generation anpanman 😂 the effort 👍 uwu
😂😂😂
Once u Jimin,u can't Jimout lol😂😂😂
Once u Jimin,u can't Jimout :*/😂😂😂😂😂😂
But did you even look at his face😍😂😂
Once u Jimin,u can't Jimout , First off, your name 😂😂😍 and TAEKOOK ❤⚠
JUNGKOOK IS SO CUTE OMG
Yesssss
0:05 1:50 2:52 cute and fuuny😍😍😍
I saw you everywhere 👏👏
Baekhyun, Seulgi & Jungkook phi Kon pppppppppppp0pppppppp
Baekhyun, Seulgi & Jungkook i agree with u
I'm the only one who think, that Yoongi can dance better ? I'm so proud of him 👏🏻
Suga Saprin they all dance good 😑
JIMIN HAS JAMS AND ITS TRUE i think she meant That he has improved
Rice fields yoongi was a god in dancing already
Suga Saprin not better cuz that's rude to the other members but dances awesome
yoongi could always dance perfect he's just so underrated in the dance category
Yoongi's part is actually my favorite part in this song especially at 0:39 💙
*WAITING FOR YOU ANPANMAN*
Seokjin !!! Such a good dancer !!!!
Fr
Why nobody talks about suga who slayed these dance moves?
#lovesuga he did it so well,
but of course the other members slayed too💎
Now I see this comment and I can't help but think about his shoulder injury, Suga seriously slayed this choreography 😔💜
Yeees! I went to the comment section to see if anyone also sees the same. He was in his element.
My little brother (4 yo) loves jhope and then he saw jhope looking like a fireman he was sooo joyful because his bias looked his heroes
*The amount of details Hoseok put into his dance moves... you can clearly see the difference*
Every time Park Jimin smiled during this performance, my lifespan increased by 2 years.
Ashmita Nandy hahahaha
Welp I guess we're immortal now :D
• Natalie • The miraculous medical benefits of Park Jimin! 😂
Ashmita Nandy lol xD
yoo, whenever he smiled, my lifespan decreased to the point where now i'm fuckING dEAD. hE'S SO AMAZINGGGSGJDhgkfdsgh
Jinnie and joonie 💜💜💜😭😭😭😭💜😍😍💜💜 slaying those dance moves
i love how i can focus on jin the whole performance bc on mnet’s version i couldnt 🥲 he is an amazing dancer so cute and fun to see
Suga you're doing amazing sweetie😍
1:51 you're not a stuntman jungkook..
KILLING IT JIN!
eu amo assistir as performances de anpanman porque todas são divertidas
Jin killed this dance he was so good
My ANPANMAN IS BTS😄😄😃😃😊☺
Choi LeePark 😂😂😂😂😂
ŲMĄ ÇRY Ą.R.M.Y ;3 .. Why😅😅
Jin has grown so muchhhh.
La canción "Anpanman" de BTS trata sobre ser un héroe en la vida cotidiana, y cómo cualquiera puede ser un héroe independientemente de sus habilidades. La letra utiliza al personaje Anpanman, un popular personaje de dibujos animados japonés que es conocido por sacrificarse para ayudar a los demás, como una metáfora para ser un héroe.
El primer verso habla sobre el deseo de ser un superhéroe, pero darse cuenta de que todas las cosas tangibles que uno tiene que ofrecer son tan simples como un Anpan, un pan dulce relleno de pasta de frijol rojo. La canción luego pasa al coro donde cantan sobre enfrentar desafíos y experimentar dolor, pero seguir perseverando y haciendo su mejor esfuerzo. El puente es una afirmación del compromiso del cantante de ser un héroe, incluso si cometen errores, y anima a otros a confiar y creer en ellos.
En general, la canción enfatiza la idea de que cualquiera puede ser un héroe si tiene la voluntad de ayudar a los demás y hacer lo mejor que pueda, incluso si no tienen habilidades extraordinarias. Es un mensaje de esperanza y aliento para enfrentar los desafíos de la vida cotidiana con valentía y resiliencia.
Sério
1:49 OMG JUNGKOOK ARE YOU OKAY 😱IT SCARED ME 😂💖 WHO TOO ?😅LOL
Erika Gomes because of your comment I repeat that part several time..
OMG 😲
It scared me too
BTS👂jHopmypttdvv
I'm addicted to this song!
I probably listened to it more than 1000 times❤❤
Once * Army OMG hahahaha I saw you in the comment section of BlackPink Forever Young😂😂😂😂
Once * Army same
I love to listen to it esp in the morning.. the songs gives a lot of energy.
Once * Army mee tooooo
Same
Lol I didn't even notice when jungkook was ruffling Tae shirt on the other channels until they zoomed in to him😂😂
I noticed in the first dance cover i saw of this and I was like ¨what? does they do that?¨ then I wantched the performances of this song in several shows again and I clearly saw it. [Spanish speaker, I hope that makes sense]
Congratulations for the coreographer! Love the Way all singers move to all side.
Jungkook is such a cute, and an angel. When they showed him trying to be like Anpanman I'm like he is Anpanman 😂😂😂😍😍
He wasn't fanning Tae, he was trying to make it look like Tae was flying like _superman_ But yeah, JK is a cutie.
XO XO oh thank you Army for telling. My mistake lol😂😂😖😖
CmymLaa🐿️👂😉
Jin always kills 2:54
I agree
I couldn’t keep my eyes off of Jin. His dancing has improved so much!
Exactly :)))))
Jungkook flapping Tae's shirt in beginning is too adorable. I PURPLE THEM ALL !! 💜💜