Akshara singhania Sabse Jada strong and best character thi Akshara singhania emotion hai og character no can't beat her first generation Yrkkh frover best Akshra Natik frover best couple Nakshara ❤❤❤❤❤
You are absolutely right, without gen 1 this show would not even be a show. It taught us about emotions and true relationships, without divorce and love triangle drama. Akshara was the strongest, because she could fight but chose to resolve with peace, rather than always picking fights or not being able to fight at all. Love naitak and akshara❤❤
@@Nusrat-j9ggo and Google Andhbhakt Shivangi fans everybody knows how she is Rajan Shahi's favourite, bootlicking and what not, not wanted to type, the highest Trp of YRKKH was 8.1, Akshara Maheshwari simple, traditional and cultural wedding got 7.4 trp and the trp of YRKKH before Cape Town i.e in 2015 was 4.2 even after completing 1600+ episodes and 6.5 years, which your favourite Gen 2 never got aur 6 saal to chala bhi nhi, In AKSHARA Era makers never needed separation divorce drama track to increase the trp was always high, but in Gen 2 there was always, I know the new generation or the so called teen loved Kaira because they were doing intimate scenes and almost liplock scenes so they liked them, but without Yrkkh Ur Shivangi Joshi is a flop, her all solo shows other than Yrkkh are flops and Disasters, still andhbhakts call her Most Popular INDIAN TELEVISION ACTRESS and No.2
@@rahulbhandari5737 without Google jab ate ho ais ehi hota hai yrkkh ke ger ek khaba rakhti hoon mein ab tum ek kutte ko khichke insaan banane ki koshish karoge to woh kutta hi rahega insaan nahi ban payega ab bogte raho and mein world tour oe hoon yaha akshara ko kam and naira ko jayda jani jati hai apna age dekho mujhe algta hai tum 100 saal ke ho and news dekho samjhe bognese pehle janke bogo 2nd gen se jayda trp wala gen aur hai hi nahi ab tum bogo aur kehte kehte mar jao sach nahi badalne wala..
Akshu first lost her mother, then father,then her sirat mumma. Her sister aaru who was her life, never behaved with her, then after so many struggles she married with abhimanyu who left her. She then met abhinav and gave birth to abhir. She then even lost abhinav. She then lost her sister aaru. Then akshu and abhimanyu reunited but fate took away her abhir and abhimanyu from her. She gave birth to abhira. She as a single mother died at end taking the blames of killing sirat mumma, Neil and aarohi. I really feel sorry for her 😭😭 love u akshu ❤❤
@@NouraAli-wx9fb 10 year with sirat & kartik then hostle 8-9 month Birla house then divorce & 1 year in morisus 3 month with manyu then divorce 7 month with abhinav in pregnancy 8 year with abhinav and Abhir.. 22 year with abhinav & his daughter abhira...
Fact is only naitik had wholeheartedly supported and loved his wife throughout the Best male of lead of yrkkh same goes to OG akshara she was one of all hell strong female lead ever yet she was more humane, relatable and soft
AKSHARA1 Singhania Sabse Jada strong and best character thi Akshara Singhania and Naitik forever best character ♥ ❤ Naira and kartik were Also Jada and best character into 2nd generation ❤❤❤Abhinav and Akshra 2 bhi forever best character thi
Sachmein sabke pass koi na koi tha...par abhira ke pass koi bhi nahi tha...hamesha sabkuch akela saha hain or akela hi mukabila kya hain....koi nahi hain apna😢
Abhira kai pass sirf auski mummy thi bachpan sai ❤ aur koi nhi tha auskai saath 💔 auskai baad abhira ki mumma ka death ho gya 😢💔 auskai baad auska aur armaan ka shadi hua ❤ lakin armaan abhira sai pyar hi nhi karta 💘 then dadi sa, vidya, ruhi, sanjay, charu, kajal sab ausai hate karta hai auska insult 😭 karta hai including armaan 😈 auskai baad armaan abhira ka divorce 💔 auskai baad armaan aur ruhi ka sadhi ka tayri 💔 abhira kar rhi hai apnai pyar ko kisi aur ka hota hua dekh rhi hai 💔.
Akshu na sbb ko kho diya tha both husband's, unborn baby , son , sister, papa , both mother's, leave family , her first love , her devar and at last died her life only for arman 😩😭😭😭😭😭😭😭😭😭❤❤❤😢
In present track abhira's condition become too much worst, now she don't have money no job no food no one to support. Now she became completely alone and fighting alone. She doesn't have any family husband friend brother no one to help her
❤❤❤❤😂😂😂😂😂😍😍 kya yah Rishta Kya kahlata fir se TV per Nahin dikhaya jaega Kya Ek Bar fir se dikha sakte hain yah Rishta Kya kahlata Hai TV per Star Utsav per Nahin to sahi Dangal 2 per dikhaiye bahut mis to please Kuchh to kijiye serial band mat kijiye Hamesha ke liye dikhaiye phone se maja to TV per hai Achcha bhi Lagta Hai Dil Ko Bhi Chhu Jata Hai yah Rish😭😭😭😭😭😭😭😭😭ta Kya😊? kahlata Hai😂😂😂😢😢😅😅
Everyone is talking about akshu naira akshara abhira but nobody is talking about sirat so sad 😢sirat never get parents love she lost her first love get blame for so many things that she didn't even done when she meet with her first love and get married then her first love gone and get blame for muder and then she know about her second love she even got married but only her mother in law and dadi and kartik love her fully and nobody and in them also only kartik was only one who gave her a special place in his heart and that also not fully and when she started to get a little bit Happy and kartik sirat chemstry start then they just show her death and one more thing in her marriage also she get blame and even after giving so much love to kairav and akshu more then aru she get called soteli and nothing although akshu is daughter of naira but her kismat is like sirat mostly and although arohi is daughter of sirat she is a real chotu serni and babbar serni of yrkkh i know she is not good but her character devlopment is the best because in last she just become like sirat caring and loving i don't care what gen is it but for me sirat naira and aru are only best and nobody specially abhira akshu and ruhi in my opinion so if you hate sirat naira or aru then just please ignore my comment because it is only my opinion ❤
Sirf natik hi Akshara ka sath dia tha kavi usse akela nahi chora and gharwalo k samne hamesa vala bura nahi kaha baki sab ka pati sirf divorce dene pe hi laga hai
kahaa pe saath the shadi ke baad Kya kya kiya tha typical husband and sasural wale bhul gaye jo naitik akshara achse honge aisee toh ghar ghar mein patni agr torture sahe toh divorce nahi hota toh kya uo log best ho Jata typical log hi inhe best kehte jo apni patni ya pati ko davake rakhte hain uo toh naksh bada hone ke shadi ke bohot saal baad death sequence mein saath diya naitik ne agr shadi ke 1 ya 2 saal mein death sequence aate toh tata kar dete akshara madam ko 😏 warna coti coti baton pe batein sunana mayke bhejna batein rakhne ke azadi na Dena konsa kasar chodha tha kahani Kya thi baas ghar ke kam khana pina tayari naitik ke coma ke waqt akshara ke bohot help karnee ke baad naitik ne akshara ka saath diya tha aur divorce issliye nahi hua kyunki tab bacho ko itne azadi nahi the gharwale conservative the divorce bade baat the unke liye issliye sulah karwa dete warna divorce ho Jata uske bade saboot coti so baat pe mayke bhejna aur kya joke mara ghar walon ke samne vala bura nahi bola ghar walei hi bol dete the uo Apne ghar walon ko support karte the saath mein khud bhi akshara ki khilaf vala bura akshara ko bolte the uo bhi coti coti baton par coti si baton par ghar se bahar nikal diya tha aur kya chayhe worst husband banne ke liye akshara agr naira abhira akshu Jaise jawan chalate toh do din bhi nahi tik pati so call best husband aur sasural mein
AksharaSinghania k sath us k Natick nay kabhi b nae chora hamesha Akshara ka sath dea Naitick nay yaha tak Naitck ko b apnay ghar walo se dur hona para tha lakin phr b Akshara ka sath kabhi nae chora Naitick nay best ever couple 1 Genration Nakshara🔥🤩😍
Abhira goenka ke ansh nahi hai ruhi birla ka hai to birla bohut paise wala hai and abhira sharma hai safar karna parega hi naira ne akele bada hua abhira ko uske ma nr bada kiya akshuke pass uske parivaar the even akshara ke pass bhi.. But naira strong thi akele bada hua hai uske liye akele ladna koi baat nahi even sirat bhi
Akshara singhania Sabse Jada strong and best character thi Akshara singhania emotion hai og character no can't beat her first generation Yrkkh frover best Akshra Natik frover best couple Nakshara ❤❤❤❤❤
Og to sab hai 😂😂😂😂 and yrkkh pe sabse jayda strong naira tha and 2nd gen 1st se jayda trp layi agar app news se door rehte ho to apps ekya hi kehna😂😂😂
You are absolutely right, without gen 1 this show would not even be a show. It taught us about emotions and true relationships, without divorce and love triangle drama. Akshara was the strongest, because she could fight but chose to resolve with peace, rather than always picking fights or not being able to fight at all. Love naitak and akshara❤❤
@@Nusrat-j9ggo and Google Andhbhakt Shivangi fans everybody knows how she is Rajan Shahi's favourite, bootlicking and what not, not wanted to type, the highest Trp of YRKKH was 8.1, Akshara Maheshwari simple, traditional and cultural wedding got 7.4 trp and the trp of YRKKH before Cape Town i.e in 2015 was 4.2 even after completing 1600+ episodes and 6.5 years, which your favourite Gen 2 never got aur 6 saal to chala bhi nhi, In AKSHARA Era makers never needed separation divorce drama track to increase the trp was always high, but in Gen 2 there was always, I know the new generation or the so called teen loved Kaira because they were doing intimate scenes and almost liplock scenes so they liked them, but without Yrkkh Ur Shivangi Joshi is a flop, her all solo shows other than Yrkkh are flops and Disasters, still andhbhakts call her Most Popular INDIAN TELEVISION ACTRESS and No.2
@@Nusrat-j9ghow old are you?? Definitely not watched or not born during 2009-12, the show was Known as Akshara Ka Serial
@@rahulbhandari5737 without Google jab ate ho ais ehi hota hai yrkkh ke ger ek khaba rakhti hoon mein ab tum ek kutte ko khichke insaan banane ki koshish karoge to woh kutta hi rahega insaan nahi ban payega ab bogte raho and mein world tour oe hoon yaha akshara ko kam and naira ko jayda jani jati hai apna age dekho mujhe algta hai tum 100 saal ke ho and news dekho samjhe bognese pehle janke bogo
2nd gen se jayda trp wala gen aur hai hi nahi ab tum bogo aur kehte kehte mar jao sach nahi badalne wala..
Sabse jyada dukhi akshu thi....use 2 pal ki khusi milti thi or jindgi bhar ka dukh 😢
Akshu first lost her mother, then father,then her sirat mumma. Her sister aaru who was her life, never behaved with her, then after so many struggles she married with abhimanyu who left her. She then met abhinav and gave birth to abhir. She then even lost abhinav. She then lost her sister aaru. Then akshu and abhimanyu reunited but fate took away her abhir and abhimanyu from her. She gave birth to abhira. She as a single mother died at end taking the blames of killing sirat mumma, Neil and aarohi. I really feel sorry for her 😭😭 love u akshu ❤❤
The most cruel is that she lived half her life alone away from her family.
Right😢😢
@@NouraAli-wx9fb
10 year with sirat & kartik then hostle
8-9 month Birla house then divorce & 1 year in morisus
3 month with manyu then divorce
7 month with abhinav in pregnancy
8 year with abhinav and Abhir..
22 year with abhinav & his daughter abhira...
Akshu suffered the most 💔💔
Characterless hoga to karega hi iske sath aise hi hona chahiye..
@@Nusrat-j9g characterless ap hogey wo nahi
Tu hai isliye kehraha hai haan charachterless ke fan to charachterless hi hota hai tere jaise.. @@editsbytalhaa
@@Nusrat-j9g lol shutup
@@Nusrat-j9g 🤣🤣🤣
Fact is only naitik had wholeheartedly supported and loved his wife throughout the Best male of lead of yrkkh same goes to OG akshara she was one of all hell strong female lead ever yet she was more humane, relatable and soft
@jeeth862'3daysagoFactisonlynaitikhadwholeheartedlysupportedandlovedhiswifethroughouthe
@Jeeth862:3daysFactisonlynaitikhadwholeheartedlysupportedandlovedhiswife
Sab ke sath aur sab se jyada ❤ abhira nand naira and akshu ka 💔
Akshu ke sath kuch jyada hi
@@poonamprajapati5748kuynki she is not strong and ulti pulti decision leta tha charachterless bhi tha.
Abhira is all alone in the world! Can't imagine her situation...
Abhiraisallaloneintheworld!cantimaginehersituation:::
Abhira Sarma ❤
Ha yaar 😂😂😂😂🎉
Sach mai abhira ne bhut suffer kiya jai plz ab abhira ki life mai happiness asni chahiye. Or abhira ne nina kuch kiye itna suffer kiya. 😊
SachmaiabhiranebhutsufferkiyajaiplzabhirakilifemaihappinessasnichahiyaOr
abhiraneninakuchkiyeitnesufferkiya😊
AKSHARA1 Singhania Sabse Jada strong and best character thi Akshara Singhania and Naitik forever best character ♥ ❤ Naira and kartik were Also Jada and best character into 2nd generation ❤❤❤Abhinav and Akshra 2 bhi forever best character thi
E34🎉😢😢😢
Sachmein sabke pass koi na koi tha...par abhira ke pass koi bhi nahi tha...hamesha sabkuch akela saha hain or akela hi mukabila kya hain....koi nahi hain apna😢
Ll is a good thing I I know you
Abira is the most unfortunate character
She has no family, no money, fighting for life alone and almost everyone in her laws disrespect her 😢
Yrkkh S4 in laws sachiyaa dekha rahe hai ki kaise hota hai😢
It's beautiful drama. And my feurite drama
👌🌷👋♥️😄🇵🇰🌻
So sad akshu
So sad naira abhira 🥺🥺🥺🥺🥺🥹🥹🥹🥹🥹😭😭😭😭
I miss Akshara character . Plz repeat telecast the episode
Kitna dardnaak gana hai dil chhu jata hai 😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢
نفس الي صار بسيرات و ناير و اكشو❤ صار بي ابهيرا
Abhira ❤❤
Abhira kai pass sirf auski mummy thi bachpan sai ❤ aur koi nhi tha auskai saath 💔 auskai baad abhira ki mumma ka death ho gya 😢💔 auskai baad auska aur armaan ka shadi hua ❤ lakin armaan abhira sai pyar hi nhi karta 💘 then dadi sa, vidya, ruhi, sanjay, charu, kajal sab ausai hate karta hai auska insult 😭 karta hai including armaan 😈 auskai baad armaan abhira ka divorce 💔 auskai baad armaan aur ruhi ka sadhi ka tayri 💔 abhira kar rhi hai apnai pyar ko kisi aur ka hota hua dekh rhi hai 💔.
Mujhe abhira ko dekhkar bohut dukh hota hai😢
❤
Mujheabhirakodekhkarbohitdukhhotahai😢
Mujheabhirakodekhkarbohutdukohotahai😢
❤😂😢😂😂
Vah vah vah kya baat hai mere ko do sunte hi Rona a Gaya so nice video😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢
Abhira itni jaldi mat maaf kerna armaan ko😢😢
Always Yrkkh Gen 2 #kaira naira
Akshu na sbb ko kho diya tha both husband's, unborn baby , son , sister, papa , both mother's, leave family , her first love , her devar and at last died her life only for arman 😩😭😭😭😭😭😭😭😭😭❤❤❤😢
Abhira ki life me Khushi ka pal kb aayega
Very emotional song special akshar moment😭🥺😔😭😭💔💔
मैं अक्षरा और अभिरा से बहुत प्यार करता हूं
Yeh rishta kya kehlata hai aj tak pta nhi chala yeh rishta kya kehlata hai
Kisine kuch kiya hi nahi tha fir bhi iljam unpe hi laga aakhir Ye Rista Kya Kahlata Hai 😢❤😢❤😢❤😢❤
In present track abhira's condition become too much worst, now she don't have money no job no food no one to support. Now she became completely alone and fighting alone. She doesn't have any family husband friend brother no one to help her
Abira ke liye koi nahin usse aur man ke sath chahie❤
Abb nahi hai per tha to chote se naira to akele pal badi hai uske pass kain tha jab akele baccha pala tab bhi akele hi tha
Yahkk best seson 4.cute couple only old armn and abhira.funny and so so butiful❤
😂😂😂 pagal abhi abhi payda hua kya 😂😂
Aththda
Aap ne baki season nahi dekhe infact yeh Arman pehle se achsa pehle ka toh villain lagta tha
Abhira 😢😢
Yar abhira ka koi to santh de do😢
Abhira armaan ko sath dikhao
@gyanrazxmeravi9829:4moagoyarabhirakakoitosanthdedo😊😢
Is show ki main Back bone to hina khan thi
Aaj bhi is show ka name jahn me aaye to akshra name hi aata hai sabse pahle
Ese Dekh ke toh mujhe bhi Rona aa jata h 😢😢
❤❤❤❤😂😂😂😂😂😍😍 kya yah Rishta Kya kahlata fir se TV per Nahin dikhaya jaega Kya Ek Bar fir se dikha sakte hain yah Rishta Kya kahlata Hai TV per Star Utsav per Nahin to sahi Dangal 2 per dikhaiye bahut mis to please Kuchh to kijiye serial band mat kijiye Hamesha ke liye dikhaiye phone se maja to TV per hai Achcha bhi Lagta Hai Dil Ko Bhi Chhu Jata Hai yah Rish😭😭😭😭😭😭😭😭😭ta Kya😊? kahlata Hai😂😂😂😢😢😅😅
😢😢 cry
Everyone is talking about akshu naira akshara abhira but nobody is talking about sirat so sad 😢sirat never get parents love she lost her first love get blame for so many things that she didn't even done when she meet with her first love and get married then her first love gone and get blame for muder and then she know about her second love she even got married but only her mother in law and dadi and kartik love her fully and nobody and in them also only kartik was only one who gave her a special place in his heart and that also not fully and when she started to get a little bit Happy and kartik sirat chemstry start then they just show her death and one more thing in her marriage also she get blame and even after giving so much love to kairav and akshu more then aru she get called soteli and nothing although akshu is daughter of naira but her kismat is like sirat mostly and although arohi is daughter of sirat she is a real chotu serni and babbar serni of yrkkh i know she is not good but her character devlopment is the best because in last she just become like sirat caring and loving i don't care what gen is it but for me sirat naira and aru are only best and nobody specially abhira akshu and ruhi in my opinion so if you hate sirat naira or aru then just please ignore my comment because it is only my opinion ❤
બહોત રૂલાતી હે યે સિરિયલ અક્ષરા ને બહોત રુલાયા અક્ષરા સિંગનિયા મારી ફેવરેટ અને નયતિક
Sirf natik hi Akshara ka sath dia tha kavi usse akela nahi chora and gharwalo k samne hamesa vala bura nahi kaha baki sab ka pati sirf divorce dene pe hi laga hai
SirfnatikAksharakasathdiathakaviusseakelanahichorandgharwaloksamne
hamesavalaburanabikahabakisabkapati
Sirfdivotcedenepehilagahai
kahaa pe saath the shadi ke baad Kya kya kiya tha typical husband and sasural wale bhul gaye jo naitik akshara achse honge aisee toh ghar ghar mein patni agr torture sahe toh divorce nahi hota toh kya uo log best ho Jata typical log hi inhe best kehte jo apni patni ya pati ko davake rakhte hain uo toh naksh bada hone ke shadi ke bohot saal baad death sequence mein saath diya naitik ne agr shadi ke 1 ya 2 saal mein death sequence aate toh tata kar dete akshara madam ko 😏 warna coti coti baton pe batein sunana mayke bhejna batein rakhne ke azadi na Dena konsa kasar chodha tha kahani Kya thi baas ghar ke kam khana pina tayari naitik ke coma ke waqt akshara ke bohot help karnee ke baad naitik ne akshara ka saath diya tha aur divorce issliye nahi hua kyunki tab bacho ko itne azadi nahi the gharwale conservative the divorce bade baat the unke liye issliye sulah karwa dete warna divorce ho Jata uske bade saboot coti so baat pe mayke bhejna aur kya joke mara ghar walon ke samne vala bura nahi bola ghar walei hi bol dete the uo Apne ghar walon ko support karte the saath mein khud bhi akshara ki khilaf vala bura akshara ko bolte the uo bhi coti coti baton par coti si baton par ghar se bahar nikal diya tha aur kya chayhe worst husband banne ke liye akshara agr naira abhira akshu Jaise jawan chalate toh do din bhi nahi tik pati so call best husband aur sasural mein
Abhinav or akhara best the kuki abhinav ne hmesha akhara ka sath diya or pyar or respect di
Akshara ❤
Very sad ❤❤❤❤ sb ke sath vahi hua h ❤❤❤
Miss you so much guys🥺🥺😢😢
Abhinav is best husband 😢
Yaha Abhinav ki bat nahi ho rahi hai to is Abhinav ko bich ma mat Lao l hate hate hate hate hate hate hate Abhinav
@SanjoKhan-h5x but why ?
❤❤❤❤❤❤❤iloveyou❤aaksaranaira❤aavira❤aksu❤
❤❤❤❤
Manish ko pata chal jae ki abhira akshra ki beti hai plz 🥺🥺
This is the reason why study matters the most
Nice 😊😊😊
In sb me naitik best hai q ki usne kbhi bhi akshara ko akela nhi choda
Abhira alway's alone kya hal hota hoga uska baki sabhi ke pas koi n koi care karne vala hai so sad❤❤😢😢
Lifes is very unfair with them so sad whos agree 😢
يا الله يا اكشارا كديش تعرضتي لضلم😢😢
Yes😢
Abhanavi ka akshay hai -> akshay ka pass surya kiran hai
akshu made Abhimanyu suffer a lot.
Very nice
Miss you yeh rishtav family 😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢❤❤❤❤😂😂
प्यार का बंधन है❤❤
So sad for niara😢😢
❤❤❤❤❤❤❤❤❤
Naira
Akshara ke pass naitik hai, naira ke pass bhi naitik hai, akshu ke pass abhinav hai, sirat ke pass kartik hai lekin a hira akeli hai.
Abhira❤😭
Or ha just like abhira wo log bhi akeli thi koi unke sath nhi tha
Ha bechari abhira akeli hai use gher se kabhi mat nikalana😢😢😢😢😢
AksharaSinghania k sath us k Natick nay kabhi b nae chora hamesha Akshara ka sath dea Naitick nay yaha tak Naitck ko b apnay ghar walo se dur hona para tha lakin phr b Akshara ka sath kabhi nae chora Naitick nay best ever couple 1 Genration Nakshara🔥🤩😍
Abhira goenka ke ansh nahi hai ruhi birla ka hai to birla bohut paise wala hai and abhira sharma hai safar karna parega hi naira ne akele bada hua abhira ko uske ma nr bada kiya akshuke pass uske parivaar the even akshara ke pass bhi.. But naira strong thi akele bada hua hai uske liye akele ladna koi baat nahi even sirat bhi
❤tgpl😊
My febarit siriwal❤❤❤
Very sad story
Kartik Naira part was the best
Samira😞♥️♥️♥️👌😂😂
Sihana❤❤😂sai❤❤❤
My favourite serial ❤
Naira is the best ❤❤❤
यह रिश्ता क्या कहलाता है सिमर उमंग पर चला दो प्लीज प्लीज प्लीज
Ab jab poddar house mein koi marega to phir abhira ko v aise hi nikalenge
Only naira❤❤
Bure waqt me in sbke patiyo ne inka sth chhoda lekin baad me sbko ek sth hi dikhaya jese ab bhi kese na kese armaan abhira k pass chala hi gya
Natik hamesa akshara ka sath dia
Sabke paas sab hai AbhiraI ke paas koi nahi hai 😂😂😂😂😂😂😂😂😂😂
Jotry❤
😮😮😮😮😮😮😮😮😮😮😮😮
1:13 2:11 3:24
Akarasa❤❤❤
God bless you heena
Ye sireyel bhoth ruladera ye abhira ka sath aise math karo plz
Akshu and Aabhi
❤❤❤❤❤🎉
😂❤
Vishum❤😊
Meme to ehy saw dhakhna band kar Diya hai jab tak old Arman ko saw me bapas nahi laya jayega ham Aya saw nahi dakhanga
I'm Kartik naira fan ❤
Sem drhtr vhri jindgi
❤❤❤❤😊😊
Ab abhira ke sath v yahi hoga
@rumpadevi6508'2moagoAbabhirakesathvyahihoga
Surya kiran ( ya rasitha khalayatha ) ( corrections)
🥺🥺👌👌
😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢😢
Yeh rishta kya kehlata hai kya?
❤🎉❤🎉😮😊
😊
254
નાયરા ભી મુજે બહોત પસન્દ હે
યે ગાના બજ્તા હે તો મુજે અક્ષરા ઓર નયતિક કી યાદ આતી હે