Catering Special Chicken Stew Recipe In Malayalam | Kerala Style Chicken Stew | Chicken Stew Recipe

Chicken Stew is a delicious meal with chicken, potatoes and sweet potatoes, onions and carrots. It’s all simmered in a rich seasoned chicken broth until tender. It’s one of our all time favorite meals (along with beef stew)!
A recipe like this chicken stew is a meal unto itself… full of protein, healthy carbs and veggies. We serve it with a salad or Easy Homemade Buttermilk Biscuits to sop up anything left in the bowl. It’s true chicken soup perfection.
ingredients
chicken-600gm
butter-50gm
cinnamon stick-3pc
cardamom-7nos
cloves-6nos
ginger-1inch pc
garlic-6nos
greenchilly -5nos
onion-2nos
salt
lemon juice-1/2lemon
potato-2nos
carrot-1big
curryleaves
coconut milk 1st-1/2lit
Coconut milk2nd-1lit
pepper-1/4tsp
garam masala-1sp
pepper powder-1/4tsp
cashews-15nos
raisin-15nos
ghee-1sp
bayleaf-2nos
chicken to be cleaned.
step 1
marination
add lemon juice salt and garam masala to be mixed with chicken and leave it for 20min.
step2
coconut milk to be taken. 1st milk-1/2lit
2nd milk-1litr
step3
badam to be soacked in water and remove its skin. then grind it in a mixi to liquid form.
step4
place a thick bottom pan on the stove and add butter to it.
then add cinnamon cloves bayleaf pepper and cardamom. fry it well.
then add ginger and garlic. fry it well.
then add onion and green chilly to it and fry it.
then add chicken. and fry it.
add carrot to it when colour change to brown.
after 5min add 2nd milk of coconut and salt to it.
then cover it until its get boiled. after get boiled add cooked potato to it.
then cover it and cook it well in small flame.
then add badam in liquid form and mix it well.
then add 1st milk of coconut and off the flame.
then place another pan and fry cashew curry leaves and raisin in ghee.
add this to our stew.
#keralastylechickenstewrecipeinmalayalam
#keralastylechickenstew
#anithastastycorner
#chickenrecipesinmlayalam
#chickenstew
#chickenstewrecipe
#chickenstewkeralastyle
#chickenstewmalayalam
#chickenstewwithpotatoandcarrot
#cookingrecipes
#cookingmalayalam
#cateringspecialchickenstew
Measuring cups purchase link in flipkart
ekaro.in/enkr2...
Silver kadhai purchase link
ekaro.in/enkr2...
Hawkins stir pan
ekaro.in/enkr2...
Prestiage tawa purchase link
ekaro.in/enkr2...
Cereamic bowl purchase link
ekaro.in/enkr2...
Stain less steal kadai purchase link
ekaro.in/enkr2...
Appa kallu purchase link
ekaro.in/enkr2...
Pigeion stainless steal Essentials purchase link
ekaro.in/enkr2...
Appa chembu purchase link
ekaro.in/enkr2...
Pigeion pressure cooker
ekaro.in/enkr2...
Appachatti purchase link in Flipkart
ekaro.in/enkr2...
Spoons Purchase link
ekaro.in/enkr2...
Serving Bowl Purchase link
ekaro.in/enkr2...
Catering Special Chicken Stew Recipe In Malayalam | Kerala Style Chicken Stew | Chicken Stew Recipe

[@nehamanu5110]

ente chechii kidu thanku so much dear YES ur XMAS series katta waiting aayirunnu njngal.waiting for fabulous series thanku hugs love 🥰🥰😍

[@FNM774]

Chicken stew nannayittund chechi 🥰🥰

[@annakuriakose9127]

Ente ponnu chechymmee🙏adipoli👌🏻ithavana Xmas polikum🥰Vellayappam receipium venam chechymme💞

[@njangandharvan6678]

നിങ്ങൾ പറയുമ്പോള്‍ ആണ് ഇതൊക്കെ ഇത്ര ഈസി റെസിപ്പി ആയിരുന്നു എല്ലാര്‍ക്കും ചെയ്യാൻ പറ്റും എന്ന് മനസിലാകുന്നത് കൊതിപ്പിച്ചു കൊതിപ്പിച്ചു കൊല്ലും നല്ല ടെസ്റ്റ് ഉണ്ടാവും അല്ലെ ചേച്ചി സൂപ്പർ ഞാൻ ഉണ്ടാക്കിയാൽ ഇത് പോലെ ആവുമോ എന്തോ നോക്കാം കേട്ടോ 🦜🦜❤️

[@Anithastastycorner]

പറയാൻ വാക്കുകൾ ഇല്ല ഡിയർ 🥰🥰

[@Leenashan]

ഞാൻ stew ഉണ്ടാക്കാറുണ്ട്. എങ്കിലും ഇതു പോലെ ഒന്ന് try ചെയ്യാം

[@DileepKumar-of4vn]

ഞാനാഢ്യമായി വാച്ചിങ് വോവൗ ബുട്ടിഫുൾ ചിക്കൻ സ്റ്റൂ. ❤️❤️🍀🍀🍀👌👌👌🌹🌹🌹🌹🌹🌹🌹🌹🙏🙏

[@VinayasWorld]

കൊള്ളാം ചേച്ചി നന്നായിട്ടുണ്ട് അടിപൊളി 👍👍

[@DileepKumar-of4vn]

ഹൈ മാഡം ഫസ്റ്റ് മാച്ചിങ് ദിസ്‌ വൻ. 👌👌👌 വെൽ സ്റെവ ചിക്കൻ. 👌👌👌🌹🌹

[@ShareefaShahulShareefa]

ശെരിക്കും കൊതിപ്പിക്കും റെസിപ്പി ആണ് ചേച്ചി contestent milk ചേർക്കുന്ന ഐഡിയ കൊള്ളാം 🥰

[@mrschefsavithri]

ബ്രെഡും stuew kandapo തന്നേ കൊതിയയി 😋😋😋😋😋😋😋

[@zayanbaby2022]

ചിക്കൻ സ്റ്റു കൊള്ളാം ചേച്ചി അടിപൊളി 😋

[@rakeshr4896]

Kollam adipoli recipe

[@FNMcookings]

Chicken stew Kandittu kothiyayi chechi 😋

[@abdulsameeh7260]

Valerie ishttappettu 👌👌👌

[@AnuLivingVids]

ചിക്കൻ സ്റ്റൂ അടിപൊളിയായിട്ടുണ്ട് ചേച്ചി 😋😋വളരെ ഇഷ്‌ടമായി 👌👌

[@aleyammavarghese9316]

Adipoli chicken stew anu... Kanan thanne സൂപ്പർ... Tastum athilum super ayerekkum

[@aleyammavarghese9316]

Roshinis kitchen world

[@PriyaNijith]

Njan innu ee resipy aanu ente veetil adhithikalk undakkunnath preparation thudangi😊

[@Anithastastycorner]

ഓക്കേ ഗുഡ് 😍

[@KokoBakeOfficial]

Wow അടിപൊളി ആണല്ലോ ചേച്ചി 😋😋

[@rehananobin5252]

ചേച്ചികുട്ടി..... ഒരുപാടു ഇഷ്ട്ടം 😘

[@Anithastastycorner]

Mole 🥰🥰🥰🥰🥰🥰🙏🏼😘

[@minimartin4152]

❤🎉🎉entha paraya orupisukkum illathe valare sathya sandhamayathsnu enikkere ishtappettu ❤❤❤❤❤🎉🎉🎉🎉🎉

[@Anithastastycorner]

Thankyou 👍❤️

[@ASOOSMIX1]

ചിക്കൻ സ്റ്റ്യു നന്നായിട്ടുണ്ട് ചേച്ചി 😋👍

[@AzeezJourneyHunt]

Chicken stew അടിപൊളി ആയിട്ടുണ്ട്

[@neethuarun3956]

കിടിലൻ ചിക്കൻ stew ചേച്ചി 😊👍👍

[@sumibaji007]

സൂപ്പർ ❤️❤️❤️
പറയാൻ വാക്കുകൾ ഇല്ല.. അത്രക്ക് ഇഷ്ടം ആയി ❤️❤️
ഒന്ന് ലൈവ് ഇൽ വന്നൂടെ

[@shynothomas2909]

Anitha a perfect recipe

[@Vlogsbymariyam118]

Waw നല്ല അടിപൊളി ചിക്കൻ stew

[@vinneybaiju7476]

Beef stew upload cheyane chechi...
Super dish.. Christmas series waiting..🥰😍

[@Anithastastycorner]

Ok മോളെ 🥰

[@jibidasharidas5002]

Suupper... Cheachi

[@Anithastastycorner]

താങ്ക്സ് ഡിയർ 🥰🥰🥰🙏🏼

[@yoginathan7076]

Just watched Turkish chicken stew recipe today.. searched chicken stew recipe in Indian style...now you going to do chicken stew in your channel..waiting to watch about your recipes detail

[@Anithastastycorner]

താങ്ക്സ് ഡിയർ 🥰❤

[@manjulanishanth1462]

👍👍👍super

[@aneeshkumar5506]

Chicken stew സൂപ്പർ ചേച്ചി..👌😋🤤👏🙌

[@Anithastastycorner]

താങ്ക്സ് മോനെ 🥰🥰

[@bindhujobi9044]

അടിപൊളി 👌👌👌👌👌😋😋😋 so simple 🥰🥰🥰🥰🥰🥰🥰🥰🥰

[@Anithastastycorner]

🥰🥰

[@ReenaAlexander-v8v]

സൂപ്പർ

[@Anithastastycorner]

Thanks👍❤️

[@Manazyachutty]

Catering spcl soya dry roastum
Ulli theeyalum pulisery recipe idamo

[@Anithastastycorner]

സോയ അടുത്ത് തന്നെ edam

[@Anithastastycorner]

ബാക്കി എല്ലാം set 🥰🥰🙏🏼

[@Manazyachutty]

@@Anithastastycorner 🥰🥰pinne moru curry...beetroot kichadii update versions okke idam ketto

[@Manazyachutty]

@@Anithastastycorner pettanu adukkala joli teerthit padikkanulla oru routine paranj tarao

[@suryasuryasurya5831]

Chicken stew adipoli 👌🏻👌🏻👌🏻

[@Anithastastycorner]

മോളെ 🥰🙏🏼

[@Shalusworldshalumon]

ചിക്കൻ സ്റ്റു അടിപൊളി 👍🏻

[@mayadileep8079]

Super. Anithede pappaya treeyil pappaya pazhuthu kidakkunnundallo. Black plateil shadow kannam.🤤🥰

[@Anithastastycorner]

ചേച്ചി കണ്ടില്ല മോനെ 🥰

[@binuak2186]

ചേച്ചി അടിപൊളി 🌹❤

[@jessygeorge3180]

Chachy kidu😋

[@rajithae1709]

Super chechi

[@vbrmelila5978]

chicken stew nannyi erikkunnu

[@usaftk187]

നന്നായി ട്ടോ

[@Anithastastycorner]

താങ്ക്സ് ഡിയർ 🥰🥰

[@sijipv5942]

Super tastyy
Thank u for this recipe

[@Anithastastycorner]

Thanks for liking💞💞q

[@bindujoseph7401]

Super chechi..... Beef stew koodi edammo 😘

[@Anithastastycorner]

താങ്ക്സ് മോളെ q🥰🥰

[@shahidaet9269]

Wow super 😋😋

[@berniedsouza669]

Looks delicious ❤

[@Anithastastycorner]

Thank you 😋🥰🥰🥰🥰

[@Binduajayvlog]

Super recipie 🥰

[@vimalafrancis6640]

Veedu evide anu

[@cpsvalleyoflove]

ഇഷ്ടായി 🎉

[@WESTERNNADANRECIPESWITHSHYNO]

well prepared

[@nadeeramali8972]

കണ്ടൻസ്ഡ് മിൽക്ക് ചേർക്കുമ്പോൾ കറിക്ക് മധുരം ആവില്ലേ. എന്തായാലും നല്ല വീഡിയോ 👍🏻

[@kcm4554]

Kerala type of cooking recipe is most unique most excellent most beautiful most delicious & most mouth watering and tasty dear most madam Anitha. Thank you ❤️ 🙏.

[@Anithastastycorner]

Thanks dear your supportt 🥰🥰🥰🙏🏼
Thankyou 🥰🥰

[@kcm4554]

@@Anithastastycorner So nice of you madam Anitha......lovely good morning you dear most madam.....wish you a best beautiful day......thank you ❤️🙏.

[@JWAL-jwal]

​@@kcm4554,*aren't you a Malayali*?

[@kcm4554]

@Karyam-- As my dear sister Anitha is Malayali, I am also Malayali though my native state is Odisha.....rather it will be more correct in saying I am Malayali as well as Odiya ❤️😍💐

[@geethushajushaju5577]

Adipoli

[@anishjames9882]

Super dear..... At last add malli ela .then it will be more tasty
...

[@Anithastastycorner]

ടേസ്റ്റി vereyakum

[@athiraa4325]

Condensed milk chertal gravyku madhuram akuvo...?

[@Anithastastycorner]

മോളെ സ്റ്റു വിനു oru ചെറിയ മധുരം ഉണ്ട്‌ അതുണ്ടായാകെ ടേസ്റ്റി ullu

[@StorieZ_at_Home]

Chicken stew super chechi🥰

[@VargheseThomass967]

A perfect recipe

[@shahidaet9269]

Waiting chechi 😊

[@Anithastastycorner]

മോളെ 🥰

[@DileepKumar-of4vn]

Mam all food watching prepare very nice. Expect vegitable. 🌹🌹🌹🌹

[@Anithastastycorner]

Thanks a lot🥰🥰🥰

[@yoginathan7076]

Today I did your recipe..ok for rice.not bad..for chappathi sure it is a delicious..it is a kurma I feel..it is good for chapathi and parota and not good for rice..good for rice and not much delicious

[@Anithastastycorner]

Thanks dear🥰🙏

[@mzsOwn123]

Chicken stew adipoli

[@sumi2048]

Chechi ❤️

[@happydaywithdhanya]

Adipoli chicken stew

[@sumifnm942]

Chechi 🥰

[@salnakitchen]

Adipoli👌😋

[@Anithastastycorner]

Stay connected

[@momscurryworld7220]

Super

[@delicious5378]

Looks so delicious 😋👍

[@WalltexDesigning]

ചിക്കൻ സ്റ്റൂ കൊതിപ്പിച്ചു

[@yoginathan7076]

Ohh koora moolaga what ingredient it is???why you didn't add it in description...now I'm stuck..now I'm cooking

[@ajitharajan8076]

ഈ സ്റ്റുവിന്റെ കൂടെ അപ്പം കൂടെ കാണിക്കൂ എല്ലാം സൂപ്പർ

[@saraswatimr6846]

Super se upar 🙏 mam, 💖💖👌

[@sabujoseph1507]

Do you really need 1½ litre coconut milk for 600 grm chicken ??

[@Anithastastycorner]

തേങ്ങാപ്പൽ ചേർത്താൽ കറിക്ക് ടേസ്റ്റി കൂടുതൽ ആയിരിക്കും പാൽ ചേർത്ത് കറി തിളപ്പിക്കാത്തത് കൊണ്ടു കൊഴുപ്പ് ആകില്ല dear 🥰🙏🏼

[@Anithastastycorner]

Ara kg chikkanu
Ara muri nalikeram mathiyakum Sir 🙏🏼

[@sinidavid6071]

Yummy

[@magivarghese9376]

ഇത് കണ്ടാൽ പായസം പോലെ തോന്നും. 20 bdam, cashu, raisens,
Butter, milk.
ഇത്രയും ingredients വേണോ സഹോദരി. ഇത് കഴിച്ചാൽ colastrol
ഇല്ലാത്തവർക്കുപോലും വേഗം
Colastrol പിടിപെടും.

[@Anithastastycorner]

Plz താങ്കൾ ഇതു ഒഴിവാക്കി ചെയ്‌തോളൂ.
ഞാൻ ടേസ്റ്റി ആയിട്ട് ഉണ്ടാക്കുന്ന വിധം കാണിച്ചു
നിങ്ങൾ ക്കൂ അതൊക്ക ഒഴിവാക്കിയും ചെയ്യാം ഡിയർ 🥰🙏🏼

[@ambadyilvineeshvs3438]

അമ്മ 👌👌👌

[@Anithastastycorner]

എന്തോ..... 😍

[@ambadyilvineeshvs3438]

✋

[@meenasp3888]

❤

[@Anithastastycorner]

🥰🥰🥰🙏🏼

[@DEEPTHYS-WORLD]

👌👌👌

[@jamsheeranoohu8971]

വില എത്ര കിട്ടും. കച്ചവടത്തിന്ന ണ്

[@Anithastastycorner]

മോളെ ❤🙏🏼

[@dhinusvlog4472]

👍👍👍

[@Anithastastycorner]

🥰🙏

[@ichiyakochi8683]

waitig cechiiiiiiiiiiiiiii vilichinnule njan ippaslabathroomil nin erangiyath

[@Anithastastycorner]

മോളെ 🥰🥰

[@Anithastastycorner]

ഇച്ചു 🥰🥰🥰

[@SheRoutes]

Chicken Stew looks so delicious 😋

[@bijumathewsdubai]

അനിതേച്ച്യേ... ഈ ക്രിസ്തുമസ്സിന് ഈ ചിക്കന്‍ സ്റ്റ്യൂ തന്നെ ആവട്ടെ. എന്താ പത്രാസ്സ് എന്നു നോക്കിക്കേ

[@asoosmix630]

😂🥰

[@aneeshkumar5506]

😂🥰

[@ichiyakochi8683]

😰😰😭😭😭

[@aneebgopalakrishnan1628]

Adipoli 😍ithu എത്ര പേർക്ക് serve ചെയ്യാം 600grm ചിക്കൻ വച്ച് 😊എനിക്ക് order വരുമ്പോൾ ആദ്യം ചേച്ചിടെ റെസിപ്പി നോക്കും

[@Anithastastycorner]

ചേച്ചി 2 കെജി ചിക്കൻ വച്ചു 16 പ്ലെയിട്ട് ആണ് ചെയ്തത്

[@anuvchacko8055]

Super chicken stew 🍲 God bless you 🙏🙏 madam pls contact number....

[@Anithastastycorner]

എബൌട്ട്‌ ഇൽ ഉണ്ട്‌ മോളെ

[@saurimathai9328]

പാചകത്തെ കാൾ കൂടുതൽ വാചകം ഓ എന്തൊരു തള്ള്😂😂

[@Anithastastycorner]

Sry 🙏😍

[@Anithastastycorner]

അങ്ങനെ തോന്നിയത് കഴ്ട്ടപാടിന്റെ വില അറിയാഞ്ഞിട്ടാ

[@treesaroy7710]

Superb

[@Anithastastycorner]

താങ്ക്സ് മോളെ 🥰🥰🥰

[@reenastephen6953]

Super

[@Anithastastycorner]

റീന ❤❤❤🥰

[@mariyammashibu8110]

Super

[@Anithastastycorner]

Thanks🥰🥰🥰

[@SusyDavid-uv3ln]

Super

[@Anithastastycorner]

Thanks❤️❤️❤️❤️