Це відео не доступне.
Перепрошуємо.
APHA World Show Amateur Yearling Stallions Part 2
- Додати в
- Мій плейлист
- Переглянути пізніше
- Поділитися
Поділитися
Вставка
Розмір відео:
- Опубліковано 19 сер 2024
- Final Results, first 7 placings.
КОМЕНТАРІ • 50
Наступне
Автоматичне відтворення
Color Class @ 2010 Appaloosa World Show.wmvgoffenas
Переглядів 152 тис.
This is Why Farmers Sell Their Weapons and Buy DonkeysWATOP
Переглядів 15 млн
APHA World Champion - Senior HUSpaintrider400
Переглядів 977
КАПИТАНА С КУРСКОЙ ОБЛАСТИ, НЕ ПРИЗНАЮТ РОДИТЕЛИ. РОМА ИЛИ НЕ РОМА? @dmytrokarpenkoApostle Dmytro Karpenko
Переглядів 1,2 млн
Бабцю КИНУЛИ росіяни! Місцеві не знають де її армія РФ. "А кто нас защищает?"Ми - Україна
Переглядів 413 тис.
🤯 ЗДУРІТИ!🔺КУРСЬК: куди дійшли ЗСУ? 🦾 Наступ на Росію ЗВІЛЬНИТЬ Донбас? Новини від ЯніниYanina Sokolova
Переглядів 605 тис.
«Це край, де я родилася й живу! І нікуди я звідси не поїду» #shortvideoСуспільне Запоріжжя
Переглядів 540 тис.
That was Scary!Ryan Rose
Переглядів 230 тис.
THE AMERICAN PAINT HORSEHorseTV Global
Переглядів 23 тис.
PHAA National Championship Show 2013 - Yearling Lungeline FuturitySandra Donovan
Переглядів 24 тис.
The Horse That Attacks You - TRT Rescue S01E01TRT method
Переглядів 360 тис.
Zan Parr Bar Part 1 (AQHA Hall of Fame Induction)carolroseranch
Переглядів 87 тис.
A Judge's Perspective: 2015 AQHYA Trail World ChampionAQHA Video
Переглядів 89 тис.
How Did I Go From THIS To RIDING In 3 Days?Ryan Rose
Переглядів 518 тис.
2018 APHA World Championship Show Highlightsaphavideo
Переглядів 4 тис.
2022 Farnam AQHA and Adequan Select World Amateur Western PleasureAQHA Video
Переглядів 16 тис.
Яшин - интервью после тюрьмы / вДудьвДудь
Переглядів 8 млн
«Ми так війну не закінчимо ніколи»: 22-річний морпіх про те, чому їм потрібні молоді #війна #зсуСлідство.Інфо | Розслідування, репортажі, викриття
Переглядів 704 тис.
Курск и Суджа России НЕ НУЖНЫ? ПОЗОР Ахмата | Антизомби 2024 - 30 полный выпускТелеканал ICTV
Переглядів 761 тис.
Державний Прапор України підняли на КУРЩИНІ в рф😍🇺🇦💪🏻 #курськ #прапорукраїни #рф #війна #наступТелеканал Конкурент TV - новини Луцька та Волині
Переглядів 433 тис.
Бутылка Air Up обмани мозг вкусомКостя Павлов
Переглядів 2,4 млн
Бабцю КИНУЛИ росіяни! Місцеві не знають де її армія РФ. "А кто нас защищает?"Ми - Україна
Переглядів 413 тис.
🤯 ЗДУРІТИ!🔺КУРСЬК: куди дійшли ЗСУ? 🦾 Наступ на Росію ЗВІЛЬНИТЬ Донбас? Новини від ЯніниYanina Sokolova
Переглядів 605 тис.
SCHOOLBOY. Последняя часть🤓⚡️КАН АНДРЕЙ⚡️
Переглядів 12 млн
They are stunning!!💞💞💞💗💕💕
My word...these yearlings DO NOT LOOK LIKE YEARLINGS! Looks like they have been on steroids.
DdAASDFSAAEYHDAWRDAARJGSARFAAQRGDAAQEGBDAAQRHGAAEYYDARGFSAQRTSSYHDAAQTUJDAQTYDAAETDAAQEYHDAWTFSAQRFAWRQWWWTUOO122!SSDSSAWSASDDSFDSRYRDYU💰💰💲💰💰💰💰💰💰💰💰💰💰💰💰💰💰💰💰🐎SWAWETGGFSAEYIJGDAQQEGHGFSAETTDAQTGGFSAAWYTAATYSARTWATPYYGDSDGGSTUGSSRYEARUYRWERSARYUESSTSSSRYUIJQQQWQERW@ QW ✈SWWWRTDAQQQWSAET@ QW 🐎QQWR2221256656775@AASFDASTUIOJYDAAWYYYYDAEYYEQTWEUTRT UTYTSYUEFEQWEQERYYSAEYUIURW
Hard to believe these are yearlings. Good grief.
All those horse s are absolutely beautiful
They sure do not look like yearlings :(
the liver chestnut with white on his belly is lame on his back leg. What are the judges thinking.
It is hard to believe these a yearlings. Poor things. Shame on the breeders and owners.
They have really run the breed into the ground! I love halter horses, raised them for many years, had a ton of winners, and the US has to go so overboard on EVERYTHING! If many take a good look, most halter horses don't live long lives! Probably a good thing though, show lives normally suck! The horses are locked up constantly and not allowed to be a horse
Yes many of them are dead before 10 from founder and other leg issues. Not to mention hypp.
What the What? Why do more half of them appear lame in at least one front leg? Poor babies.
because they most likely are. Many halter horses have horrible front legs. It comes out of impressive.
I would like to see a detailed break down of what lead to the placement of each of the top 6 horses placed in the competition. I think it would be interesting if breed shows would post the their score cards in each area used to place each horse! What do you think? Take some of the who's who's out of competition
Beautiful Horses just gorgeous!
It sure is!
(1:31) Just As Predicted. wOW. He looks like his daddy (Brooks or Dun).
I thought he was the best of the group. Tough (with a Capital "T") competition.
Thank u for sharing!!!
Una consulta.
El caballo Pinto es el mismo cuarto de milla pero con manchas.!!?
This is crazy!
How beautiful!!
Wow those horses sure don't look like yearlings
the roan is very lame aswell, disgusting. Its probably a guise to breed for meat, later.
This is disgusting. How can anyone think this looks okay?
I thought the reason for halter classes was to showcase the top quality horses of the breed who are made to succeed in shows and at the farm. To show a good example of the breed and how the ideal look.
Take any of these horses and they wouldn't last a week! They're bred for nothing else than to stand there and look pretty, and they even fail at that!
These horses look deformed and it makes me seriously consider where humans have gone wrong to allow this to even be a thing!
que lindo cavalo é esse
Tutti esperti.....di catenelle in bocca! Possibile che sia cosi' difficile condurre un cavallo a mano?
I live in the uk and i dont recognise the breed of all these yearlings, could someone tell me?? They all look so different to most horses i see in the uk. Their quarters are huge with muscles yet finer at the shoulder, virtually no withers, a flat back and when they walk they all look very stiff. Is this typical of the breed? A
They are Paints. Similar to Quarter Horses (also bred in the USA) but with white markings. Quarter horses, Paints, and Appaloosas are all much more muscular than Thoroughbreds and Arabians, but they are not all like these yearlings. These yearlings were bred to be "halter" horses, meaning they are shown for their bodies and appearance rather than their ability to perform. Think of it as a muscle man or body builder competition for horses. They are kept in the barn and fed a lot of high-protein grain so they build a ton of muscle which looks good, but it makes them walk stiff like you noticed and they are often poor performance horses. Quarter horses and Paints that are bred for performance (riding) are usually lighter muscled, look quite a bit different, and move much more effortlessly than halter horses.
+lucy5471 the USA is breeding for deformed looking horses. Lots of these are Impressive bred horses, and like you said, they look ridiculous. And many have muscle problems.
Unfortunately, this is normal for the stock type halter division---lead and feed---the majority of these babies will never be able to be ridden or do anything else besides halter.
bonitos caballoa
terrible , is there no end to the idiocy , force feeding these poor animals, is there no animal welfare in the us?
We have animal welfare for underweight horses, but not obese ones. Americans love the look of an obese horse. Many people here think an overweight horse is healthy, and a healthy one is underfed.
e muito bonito
You won’t see these horses in the ring at six years of age, they will be broke down by then. Sad.
There's paint horses " then " there's these beauties WOW .
Nothing beautiful about this breeding...bad necks, bad legs, bad withers, over muscled. These horses are useless.
Also, can someone let me know what APHA stands for too please! Knowing that will probably answer my previous questions listed below. Hello America from the not so sunny UK :-)
It stands for American Paint Horse Association
Oh gosh, besides the terrible confirmation and weight issues, why is this lip chain thing so popular these days? It’s so dumb and the horses are usually really flinchy and fussy/reactive to them. Why can’t they be easy to handle with just a regular lead or chain under the chin even like they used to do without problems? I just don’t get it at all.
The coloring looks so unnatural and they all have the exact same gait and confirmation. Almost as if they are clones with variations in the color placement. Very weird......
The colors are natural for a paint. However the frame overo carries a genetic faulty gene called lethal white syndrome. It's the bodies under the hide that's a mess.
Horse abuse! nothing more to say
I agree with you. Horse breeders do they really love horses? I don't think so. Poor horses😢
those are some of the ugliest, most painful-looking gaits I've ever seen on horses. if I saw a horse at my barn walking like that I'd be calling a vet! I can't even tell if it's lameness or just how damn overmuscled they are that it restricts their range of movement. it looks horrid at best and is actually painful for the horse at worst. at least a couple are definitely lame.
Some of it is the breeding. Impressive horses tend to have bad legs. Some have front legs that at the knee they *rock and shake* then sometimes the ankles rock and pop over the hoof. Laminitis and other leg issues run rampant in these horses.
why do u think he didn't win his lame on his back right leg
That 5th place horse had some of the worst withers on a horse I've seen. I'm sorry but these are some of the ugliest horses.....huge heads on some of them, horrible legs on others and the ones withers. Paints the longer they breed them the junkier they get.
So overweight!