Life just hurts doesn't it? Well I dont think there's nothing we can do to avoid them can we? If you ask me, I'd say I use music to get over them. Take this song for example. The lyric "Someday we'll get there" resembles how we can get through our hardships and we can make it out of it. I'm not sure if that is what it actually meant, but I see it in that point of view. These things are just a parcel of life and it's on you how you want to take it. Anyways, wishing you best of luck in your life
@@DarkzzMusicOfficial Thank you so much. Life surely hurts now, but I definitely learnt some things. Even though it's still hard to breathe and not to cry, I will try my best to keep moving. Thank you 😌
Castles glitter under spanish skies I'm just looking out for you tonight We use to run around this ghost town Always thinking out loud How we gonna get out I remember We dreamed of places we could go Castles with a strange glow People that we don't know I remember We left a life that's ordinary from the start We looked for stranger things Cause that's just who we are Found me the edge of something beautiful and loud Like i'm picturing now Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in a foreign state Tell me someday we'll get there I see a technicolor shadow Underneath your window Just in case you don't know I can see it You cast an unfamiliar day glow Different then what I know Shining like a halo I can feel it We turned our backs on ordinary from the start We looked for stranger things Cause that's just who we are Found me the edge of something beautiful and loud Show me the sky falling down Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in an ancient place Tell me someday we'll get there Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in an ancient place Tell me someday we'll get there Now you can see the lyrics while scrolling down the comments, thank me later
There's some magic in Alan Walker's music that makes everything lit! Even the remixes have more views than the original. It's called warmth. He knows exactly how to make a song better.
MY NAME IS LILY I'm FADED . I'm ALONE I'm TIRED I LOST CONTROL So SING ME TO SLEEP. When it ALL FALLS DOWN. Into the DARKSIDE. With the FORCE of the SKY. A ROUTINE to IGNITE. THE SPECTRE of unbreakable DIAMOND HEART. And I'm ON MY WAY to THE DIFFERENT WORLD! traducción : MI NOMBRE ES LILY Estoy desvanecido . Estoy solo Estoy cansado PERDÍ EL CONTROL Así que cántame para dormir. Cuando TODO SE CAE. En el lado oscuro. Con la FUERZA del CIELO. UNA RUTINA PARA ENCENDER. EL ESPECTRO del CORAZÓN DIAMANTE irrompible. ¡Y estoy EN MI CAMINO hacia EL MUNDO DIFERENTE!
Those who are alone on valentine's day, remember that you are not alone. We got each other, and this remix here, we are united. One team, one person, one unstoppable force. Walkers unite!
This song gets stuck in my head over and over throughout the years it's been out. This has more depth than the original and matches the lyrics a bit better depending on if your outlook is more positive.
I'm Brazilian and I love your songs, I only listen to them, faded, the specter, specter, force, 135, etc ... All of us Brazilians put their songs in raves and parties, could you do some of your songs with ALOK here in Brazil? We Brazilians always had the desire to see you Alan Walker here in Brazil!
calm bro there is still some good music out there have you try lonely world from k-391. and it's not like the good time has passed, fast foward 2 years later you will be here again cherish this moment you used to considered as the end of those good time so don't be sad keep your head up and look forward to the future it got alot in store
You guys just want bass and beats in every other song, you'll never understand the beauty of the original version just because you just don't have a taste !
Hey Alan, I love this song! The base, the melody and the most important, the lyrics, because the Spanish castle always glitter under the sky! (from Madrid, Spain) 👍🏻
Stranger things We're like, like we're stranger things (very far) We're stranger things (dream of places at) 'Cause that's just who we are We'd used to run around this ghost town Always thinking out loud Are we gonna get out I remember We dream of places that we could go Castles with the strange glow People that we don't know I remember We left a life That's ordinary from the start We looked for stranger things 'Cause that's just who we are Found me the edge of something beautiful and loud Like I'm picturing now Castles glitter under Spanish skies But I'm just looking out for you tonight Snow white mountains in a foreign state Tell me someday we'll get there Someday Someday Ooh-ooh Ooh-ooh I see a Technicolor shadow Underneath your window Just in case you don't know I can see it You cast an unfamiliar day glow Different than what I know Shining like a halo I can feel it We turned our back on ordinary from the start We looked for stranger things 'Cause that's just who we are Found me the edge of something beautiful and loud Show me the sky falling down Castles glitter under Spanish skies But I'm just looking out for you tonight Snow white mountains in an ancient place Tell me someday we'll get together Someday Someday Ay, ooh ooh Ooh ooh A stranger things We're like, we're like a stranger things (very far) We're stranger things (dream of places at) 'Cause that's just who we are A stranger things We're like, we're like a stranger things (very far) We're stranger things (dream of places at) 'Cause that's just who we are A stranger things We're like, we're like a stranger things (very far) We're stranger things (dream of places at) 'Cause that's just who we are A stranger things We're like, we're like a stranger things (very far) We're stranger things (dream of places at) 'Cause that's just who we are A stranger things We're like, we're like a stranger things (very far) We're stranger things (dream of places at) 'Cause that's just who we are
I just usually hate remixes,Because it ruins sweetness of original song But honestly when this guy remixes the song.... i m just wow!!!! Dont know what is the magic in this guy's music style....
Hey person scrolling through the comments right now, you'll probably never see me ever again because I'm only 1 of the billions people out there, but all I wanted to say was, I hope you have a wonderful day. Don't let anyone or anything bring you down. You're special in your own way and don't let anyone or anything take the feeling of being special away from you. Love 💕💕💕💕❤❤
Everytime i hear this song makes me wanna see my friends and we together enjoy the view of the night in the most beautiful beach and dance together with this song... aarrghhh i miss my friends
Alan...I'm a big fan of yours, I love your music, specially this remix. I'm one of your biggest fans, but whenever I listen to this song, I can't stop my feelings... I feel I Love You... Yeah!! I Love You I Love You Alan...♥️ I Love You and Your Music
LYRICS: Castles glitter under spanish skies I'm just looking out for you tonight We use to run around this ghost town Always thinking out loud How we gonna get out I remember We dreamed of places we could go Castles with a strange glow People that we don't know I remember We left a life that's ordinary from the start We looked for stranger things Cause that's just who we are Found me the edge of something beautiful and loud Like i'm picturing now Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in a foreign state Tell me someday we'll get there I see a technicolor shadow Underneath your window Just in case you don't know I can see it You cast an unfamiliar day glow Different then what I know Shining like a halo I can feel it We turned our backs on ordinary from the start We looked for stranger things Cause that's just who we are Found me the edge of something beautiful and loud Show me the sky falling down Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in an ancient place Tell me someday we'll get there Castles glitter under spanish skies I'm just looking out for you tonight Snow white mountain in an ancient place Tell me someday we'll get there
![Alan Walker vs Coldplay - Hymn For The Weekend [Remix]](http://i.ytimg.com/vi/mOivOlP9GRk/mqdefault.jpg)
![Alan Walker vs Coldplay - Hymn For The Weekend [Remix]](/img/tr.png)
:D
K-391 !!!!!
k-391 😱😍😍😍😍😍 i love you 💖
2 legends
I love your music :3
Hi
*perfection in one song*
Cami Currao good song
Good song dude
Sounds amazing
DJ AG 私はこの歌が大好きです
DJ AG I speak Japanese and English if u dont understand 私はこの歌が大好きです it said I love this song
Hey I am 16 year old Dj/Producer I have made 12 songs . Need your feedback to improve . of not, have a great day and don't forget to be awesome! 😄😄😄
DJ AG 最高です
Melody too
My longest, most beautiful and purest relationship ended yesterday.
This song keeps me moving and hurts at the same time, huh...
Life just hurts doesn't it? Well I dont think there's nothing we can do to avoid them can we?
If you ask me, I'd say I use music to get over them. Take this song for example.
The lyric "Someday we'll get there" resembles how we can get through our hardships and we can make it out of it. I'm not sure if that is what it actually meant, but I see it in that point of view.
These things are just a parcel of life and it's on you how you want to take it.
Anyways, wishing you best of luck in your life
@@DarkzzMusicOfficial Thank you so much. Life surely hurts now, but I definitely learnt some things. Even though it's still hard to breathe and not to cry, I will try my best to keep moving. Thank you 😌
@Disha thank you!
Kygo and onerepublic in one song😍😍
then alan's remix
man its lit...😍😍
Best valentine gift😍
Walkerzzz rock😉😉
Savitri Paliwal youo
Omg Alan liked your commenttt
Orang mana coy ?? :V
Why everything Alan Walker is soo perfect??😍
Avicii
Alan
Kygo
All time favourites💯❣️☺️
Alan Walker is my most favourite music artist 🥰🥰🥰
reverse the sequence.
same
and the chainsmoker he's good too
@@RobynFrost yes man mine too
That Old Vibe > Was Awesome!!
Ohhhhmmaaan it nostalgicc:")
Heart from Alan Walker, yet no likes. This proofs that Alan reads all comments :)
@@ZapDon777Music yea
@@ZapDon777Music im so happy
Muahahaha
ʜɪ ᴘᴀᴛʀɪᴄᴋ...ᴄᴏɴɢʀᴀᴛs ᴄᴜᴢ ʀᴇᴄᴇɪᴠᴇᴅ ʟɪᴋᴇ ғʀᴏᴍ ᴀʟᴀɴ ᴡᴀʟᴋᴇʀ....ɪ ʜᴏᴘᴇ sᴘᴏɴɢᴇʙᴏʙ ʙᴇ ᴊᴜsᴛ ғɪɴᴇ😂
Happy Valentine's Day, Walkers ♥ ♥ ♪ ♫
Desde Ecuador
Sandy García 👌✋
🇪🇨
Sandy García thanks😘
💛💙❤
Sandy García x2
Awesome remix i love you Alan Walker
Me too!
@nicholas wira angkasa xdddddd
Yes Best Nation I love
Best Nation
❤️
I miss this old Alan walker style music
Same here
❤❤❤
❤❤
Awesome 👌🏼
Pro Launchpadder Oh hi there
Hola perros
Hola prro :v
Pro Launchpadder I never think, one day, i'll found you here!!
"castles glitter under Spanish skies" WOW the way he says it is so beautiful!!
Yeah!!!
One republic😍😍😍😍
Ryan Tedder ❤
Its so catchy!!!
Its so goooood!!
No Lying. *This is My Favorite Remix of whole Life.*
December 2020
Original song: 37 million
Alan Walker remix: 43 million
BECOZ ALAN WALKER IS BEST
Ok but too be honest he made this song lit
A fan of alan walker forever
@@Harry119music I said because I want to, you just don't talk nonsense
But the original deserves more views😪
*this song gave me memories of things that didn't happen*
IKR IT'S LIKE BEING WITH SOMEONE SPEICAL ON A HIKE UNDER THE STARS
It makes me feel like I'm in some national park forest in Canada under clear skies surrounded by grass and mountains
Yeah it does that to me too.
Woaahh it does that to me too!
@Kenya fang bro same. I thought I was the only one who thinks of memories that have never happened or existed.
Amazing! ❤️
:0
HOLA¡ que haces aqui?
Castles glitter under spanish skies
I'm just looking out for you tonight
We use to run around this ghost town
Always thinking out loud
How we gonna get out
I remember
We dreamed of places we could go
Castles with a strange glow
People that we don't know
I remember
We left a life that's ordinary from the start
We looked for stranger things
Cause that's just who we are
Found me the edge of something beautiful and loud
Like i'm picturing now
Castles glitter under spanish skies
I'm just looking out for you tonight
Snow white mountain in a foreign state
Tell me someday we'll get there
I see a technicolor shadow
Underneath your window
Just in case you don't know
I can see it
You cast an unfamiliar day glow
Different then what I know
Shining like a halo
I can feel it
We turned our backs on ordinary from the start
We looked for stranger things
Cause that's just who we are
Found me the edge of something beautiful and loud
Show me the sky falling down
Castles glitter under spanish skies
I'm just looking out for you tonight
Snow white mountain in an ancient place
Tell me someday we'll get there
Castles glitter under spanish skies
I'm just looking out for you tonight
Snow white mountain in an ancient place
Tell me someday we'll get there
Now you can see the lyrics while scrolling down the comments, thank me later
SpectraBlade thank tou
Thank you
SpectraBlade thank youuu
Thank you much Spectra!
thank u
This is magic
Omg eres una maquina con esas músicas electrónicas alan eres el mejor
DiErMiDa si el es el mejor me encanta su musica como me gusto mucho all falls down jaja😃
Hmmm now alone tell me
If Alan walker remake any song ... It's greater than the original..... Lub u walker
I love you Alan walker 🔥 your remix / song and video are the best in the world
*_Kygo + One Republic + Alan Walker = Incredible perfect_*
TheKingMeme' you're right man
YES MAN
NO IT EQUALS ULTIMATE MAGIC
@@levu9028 emqeqwgmwgemqtmrhfemqheqtemrmqeqtqhqmmeermrkqqgmfemqgeememmiemeqmqemqmqehlqeqrfemqhqgeqgjemqqtmtqgheweqqgwfqemefejjehqqtqmjqmwg que#
They should make a song like that.
Holy guacamole, this is the holy trinity of music right here you guys 🔥
Alan walkers remix = Pleasure to my ears!
There's some magic in Alan Walker's music that makes everything lit! Even the remixes have more views than the original.
It's called warmth. He knows exactly how to make a song better.
Soooo true bro😉😉😉
Lead synth is his key
Wow jenius
I agree!!!!
Right he I soooo special
love IT ❤️
💚
Музыка для UA-cam / Без авторских прав / АП we were sleeping
Музыка для UA-cam / Без авторских прав / АП I get the joke u like the movie IT
MY NAME IS LILY
I'm FADED .
I'm ALONE
I'm TIRED
I LOST CONTROL
So SING ME TO SLEEP.
When it ALL FALLS DOWN.
Into the DARKSIDE.
With the FORCE of the SKY.
A ROUTINE to IGNITE.
THE SPECTRE of unbreakable DIAMOND HEART.
And I'm ON MY WAY to THE DIFFERENT WORLD!
traducción :
MI NOMBRE ES LILY
Estoy desvanecido .
Estoy solo
Estoy cansado
PERDÍ EL CONTROL
Así que cántame para dormir.
Cuando TODO SE CAE.
En el lado oscuro.
Con la FUERZA del CIELO.
UNA RUTINA PARA ENCENDER.
EL ESPECTRO del CORAZÓN DIAMANTE irrompible.
¡Y estoy EN MI CAMINO hacia EL MUNDO DIFERENTE!
Amazing 😍😍😍
Where is Live Fast !!!
Nicely done
Wow
kygo , one republic and Alan Walker on a single song.....😭😍🤐🤐🤐🤐
SAarthk hey check out my channel
wow❤
I’ve been looking for this song for ages. I discovered this as a young child and i finally found it in 2023. i love it
Those who are alone on valentine's day, remember that you are not alone. We got each other, and this remix here, we are united. One team, one person, one unstoppable force. Walkers unite!
Lightspark i know im not alone!
-Alone(AlanWalker)
Lightspark Well said
We all r walkers and a team .
I never feel alone cause i have the Walker
Thanks to both Kygo and Alan for this amazing song and remix lets also give a round of applause to OneRepublic for the amazing vocals!
sehebat itu mereka sukses sell buat mereka❤
Happy valentin you Alan walker
Any one from 2024
Yes
Yes❤
Yes 😊❤
Present!
Yes! I hear that song in first time I love it 💓🤩🤩❤️❣️🤩❤️
Alan Walker and kygo
😍😍😍❤❤❤❤❤❤
Thank you so much Alan
This song has made memories in my life.
I remember someone from its lyrics and music...And I begin to miss him very badly💕💕
I feel bad so here's a like
I feel bad so heres a like
Sound good, we love you! :)
Kygo and OneRepublic made an amazing song
Alan Walker made it legendary ✨
Should I cry or laugh, idk why but this remix gives me mixed emotions . Thanks Alan 🙏
Kygo and alan walker!!! Omg😘😘😘😍😍😍🖤
Best part 0:00 - 3:13 ❤️
I agree
TTV BTW no 0-3:13 but 0:00 - 3:14
Yh the last second was bad
Komo cuando tu vida es una puta mierda y lo unico que sabes hacer es criticar buena musica
pero si estan diciendo que la mejor parte fue todo el video xDD
2022 💜 escuchando este grandioso éxito que nunca pasa de moda 😭
don't understand you but hey at least i know im not the only one hearing the tune that was created 4 years ago
🔥🔥🖤😎✌️
Mee too. UA-cam just recommended it
Excelente canción me trae recuerdos ya dolorosos y a la vez lindos
@@Randommtf ñ
I LOVE ALAN WALKER! ❤
I LOVE THIS REMIX!! ❤
I LOVE KYGO!❤
I LOVE ONE REPUBLIC! ❤
THIS IS A LYRIC VIDEO! ❤
SO PERFECT!!! ❤❤❤
Summer vibes
u a gae
Fr 💙
❤Loveee ❤ You Alan Walker 😍Love❤ Love❤ Love❤ Love❤....
idailva Oliveira do u really love Alan Walker cause u sended a lot of heart emojis.
And the love face emoji (I don’t have anything against u just wondering why)
"castles glitter under Spanish skies. I'm just looking out for you tonight"
All ways makes me think of him....❤️🎶
His songs are amazing, I love them, they transmit a lot of energy! And it's what I like about their songs!
Happy Valentines Day! ✌
And awesome remix❤❤
ALAN WALKER is a god. Everything he touches is golden
thats kygo
While Miguel Zavala may be right this is Kygo. I still have to agree. Alan does have a Midas touch.
This song gets stuck in my head over and over throughout the years it's been out. This has more depth than the original and matches the lyrics a bit better depending on if your outlook is more positive.
The most beautiful part is *Castles glitter under spanish skies* 👍
vinit payal woah alan loved your comment
Alpha Gamer yes bro
vinit payal u r Indian I 🤔
I started thinking U were the original Martin Garrix than I noticed ur name😂😂😂
Ultra Nova lol
I'm Brazilian and I love your songs, I only listen to them, faded, the specter, specter, force, 135, etc ... All of us Brazilians put their songs in raves and parties, could you do some of your songs with ALOK here in Brazil? We Brazilians always had the desire to see you Alan Walker here in Brazil!
a brazilian who can speack english? thats new
Fábio Guerreiro speak*
Tenta da uma d inteligentao mas nem falar ingles corretamente sabe
D3monBR ss mas sem essa merda d alok
Specter? Só existe Spectre e The Spectre! Que onde você tirou "Specter"?
in love with Alan Walker😍😍
Love from India🤩🤩
Techy Gaurav me 2
Yea
me 2
Me too
Yes, technical chutiya
Viví una nostálgica etapa de mi vida con esta canción.
*E X E L L E N T*
Please make a new version of FORCE!😉😀
FF I wait a restrung version of “the specter” or a “force” version whit letter (sorry for my English I’m Chilean)
SkyBlueNecktie really???
SkyBlueNecktie omg i didn't see
Force with lyrics would be so littt hope he will
Yes it will be reacreated....
He confirmed in comments section of live radio
It sure takes me back in time and I hate that I can't do anything but shred some tears and cherish those moments.
Thank you Alan!
Same bro.
calm bro there is still some good music out there have you try lonely world from k-391. and it's not like the good time has passed, fast foward 2 years later you will be here again cherish this moment you used to considered as the end of those good time so don't be sad keep your head up and look forward to the future it got alot in store
@@Randommtf Thanks mate for this!
@@Randommtf that's beautiful
love u alan :)
always amazing
AMAZING TRACK 😉❤️🎉👏
mano willinha
Rosita Alcatel hi, whats up
Hello bro subscribe my channel im new production
00:45 I fall in love
Jannic hahajahahahhay 😍😍😍😂😂😍
me too
me too
me too
me too -----
👏👏
Balkan voli Walker Songs Yey
102 K de subscribers 👏👏
Amazing 🔥
I'm amazed how Alan turns cool songs into masterpieces ! Genius !!! Look forward to continuing
He turned a masterpiece into a cool song in this case.
He turned a masterpiece into a legendary diamond
He redid a masterpiece into an okay song the original was far better no hate tho I love them both just stating facts
You guys just want bass and beats in every other song, you'll never understand the beauty of the original version just because you just don't have a taste !
@@samiahmad5987 I do.. the original song's so beautiful too.. But I like this one cuz I have a taste for his signature 'Walker Pluck'
Alan Walker was wearing a mask before it was cool, what a legend
😂😂😂
Oh trust me wearing a mask because of an airborne viral disease is NOT cool, not at all...
ajcook7777 r/wooooooosh
cause hes ugly hes no legend dont get it mixed up
J Wang he's probably better looking than you....but i'm positive he more legendary than you....AW ❤️
Hey Alan, I love this song! The base, the melody and the most important, the lyrics, because the Spanish castle always glitter under the sky!
(from Madrid, Spain) 👍🏻
Stranger things
We're like, like we're stranger things (very far)
We're stranger things (dream of places at)
'Cause that's just who we are
We'd used to run around this ghost town
Always thinking out loud
Are we gonna get out
I remember
We dream of places that we could go
Castles with the strange glow
People that we don't know
I remember
We left a life
That's ordinary from the start
We looked for stranger things
'Cause that's just who we are
Found me the edge of something beautiful and loud
Like I'm picturing now
Castles glitter under Spanish skies
But I'm just looking out for you tonight
Snow white mountains in a foreign state
Tell me someday we'll get there
Someday
Someday
Ooh-ooh
Ooh-ooh
I see a Technicolor shadow
Underneath your window
Just in case you don't know
I can see it
You cast an unfamiliar day glow
Different than what I know
Shining like a halo
I can feel it
We turned our back on ordinary from the start
We looked for stranger things
'Cause that's just who we are
Found me the edge of something beautiful and loud
Show me the sky falling down
Castles glitter under Spanish skies
But I'm just looking out for you tonight
Snow white mountains in an ancient place
Tell me someday we'll get together
Someday
Someday
Ay, ooh ooh
Ooh ooh
A stranger things
We're like, we're like a stranger things (very far)
We're stranger things (dream of places at)
'Cause that's just who we are
A stranger things
We're like, we're like a stranger things (very far)
We're stranger things (dream of places at)
'Cause that's just who we are
A stranger things
We're like, we're like a stranger things (very far)
We're stranger things (dream of places at)
'Cause that's just who we are
A stranger things
We're like, we're like a stranger things (very far)
We're stranger things (dream of places at)
'Cause that's just who we are
A stranger things
We're like, we're like a stranger things (very far)
We're stranger things (dream of places at)
'Cause that's just who we are
I just usually hate remixes,Because it ruins sweetness of original song
But honestly when this guy remixes the song....
i m just wow!!!!
Dont know what is the magic in this guy's music style....
Fadadu Harshad its called awesome extraordinary amazing epic crazy good skillz
Rohil Bhattacharya boi it's probably not his first language
Fadadu Harshad I feel exactly the same
Rohil Bhattacharya do you English LMAO
SAME!
A song called "Stranger Things", made by Kygo, featuring OneRepublic, and remixed by Alan Walker... Have I died and gone to heaven?
@craig the default skin And someone like your comment 1 year and 1 day later.
I thank the same
eriky silva I think I broke it but still liked
I've been shucked and gone to heaven~ Minho, The Maze Runner 😀
Ash Morris probably
Readers of this comment: Wishing you much success, love, health and happiness! God is with you always!
The best part of the song is
*"Castles glitter under Spanish skies"*
LOL
yeah.. agreed
√
True text
💯💯
The best part is "we left a life that's ordinary from the start "💖
Every song you chose to remix it, its BEAUTIFFULL!!!!!!! ❤❤❤❤❤❤❤❤❤❤❤❤
6 years ago and I still listen to this song, full of nostalgia and happiness thanks to Alan Walker STRANGER THINGS
Alan Walker incrível remix 👍 BRASIL
BRASIL PORRAAA
*BRASIL!* 💚💛💙
Ae men br porrra kkkk
BR !!!!
Brasil 💙
Hey person scrolling through the comments right now,
you'll probably never see me ever again because I'm only 1 of the billions people out there, but all I wanted to say was, I hope you have a wonderful day.
Don't let anyone or anything bring you down.
You're special in your own way and don't let anyone or anything take the feeling of being special away from you.
Love 💕💕💕💕❤❤
Thank you. You might see yourself as only one of billions but you are ONE of billions. You are unique and special. 👍
Tysm!
Wish you a great day too!
one day we'll be the old people to a new generation hhh wow
Alan is a legend, i have been listening to him since i was 5, and, Alan, if you agree, give a heart to this comment
@Seema Verma :(
5 years later this song still hit me the same.❤
Alan Walker ur a legend!! Love ur music
Everytime i hear this song makes me wanna see my friends and we together enjoy the view of the night in the most beautiful beach and dance together with this song... aarrghhh i miss my friends
Kygo + Alan Walker = perfect
1:00 this beat 🔥🔥🔥
Alone for the Valentines day
agree with u
...
same. :(
Elvis 楷森 **im not im not aloneee**
same
Plus one
Everything that Alan Walker remixed it will be more better...
That truth
SilentKiller AF true
More better?
It's the best song ever with the best remix 👍👍👍
This generates a lot of nostalgic feeling 😭😭😭
Alan...I'm a big fan of yours, I love your music, specially this remix.
I'm one of your biggest fans, but whenever I listen to this song, I can't stop my feelings...
I feel I Love You...
Yeah!! I Love You
I Love You Alan...♥️
I Love You and Your Music
0_0
Shes not creepy. Shes expressing her love towards alan walker's music
@@ThisisSwudlo that's creepy in my book
Me too
👍👍👍
So good to hear when the line comes
Castles glitter in the Spanish skies
But I'm just looking for you tonight..!!
Litterary heard this lines when i was reading the exact same words LOL
This is my favourite song in the whole entire world 🌍
have a strike of a like from my side 'cause this is my favourite (world's best song)
@@shobhasahu2529 Mera bhi
@@divyendumishra5081 youare Indian
Actually I'm Harshita it's my mother's phone cause I am just of 15 31 jan
miss the good old times. todays phonk hearing kids will never understan what alan walker and marshmello is
"Castle glitter under spanish skies" *1630 Flashbacks*
I know right?
Assassins creed 😍😍
It reminds Me 1500
@@EDMbubble Wowiee! Ive forgot to play that game ive used to play Assasin Creed in my PSP
@@Senokov haha Me In My Pc 🙂
I love ALAN WALKER
"I'm not alone"🎵🎵
You probably know him because every person uses his songs in their videos
Tanis Extrem igual yo!!!
Tanis Extrem también el mainkra como veo v:
Hello amigo
Love you Alan 😘😍😍😍
Me too XD
I love all Alan Walker remix
Best Remix again from Alan Walker
I don't know if I like this remix or the remix of again
It right
avicci - alone
Agree
alan walker's ghostproducers*
Sou apenas um BR que gosta de Alan Walker!!!😊
william gustavo é Nóis!
🌞 Pô, Legal em
Fds
Enos
É nois
LYRICS:
Castles glitter under spanish skies
I'm just looking out for you tonight
We use to run around this ghost town
Always thinking out loud
How we gonna get out
I remember
We dreamed of places we could go
Castles with a strange glow
People that we don't know
I remember
We left a life that's ordinary from the start
We looked for stranger things
Cause that's just who we are
Found me the edge of something beautiful and loud
Like i'm picturing now
Castles glitter under spanish skies
I'm just looking out for you tonight
Snow white mountain in a foreign state
Tell me someday we'll get there
I see a technicolor shadow
Underneath your window
Just in case you don't know
I can see it
You cast an unfamiliar day glow
Different then what I know
Shining like a halo
I can feel it
We turned our backs on ordinary from the start
We looked for stranger things
Cause that's just who we are
Found me the edge of something beautiful and loud
Show me the sky falling down
Castles glitter under spanish skies
I'm just looking out for you tonight
Snow white mountain in an ancient place
Tell me someday we'll get there
Castles glitter under spanish skies
I'm just looking out for you tonight
Snow white mountain in an ancient place
Tell me someday we'll get there
This is a lyrics video bro
@@alanjackson1765 but the lyrics in the video are hard to follow along with some people need the lyrics in front of them so they know whats next
Everyone is blessed with some talent where no one can match them..and doubtlessly Alan Walker has this talent with Music
How does this not have 100M views
*Walkers would watch this*
Walkers unite
OMG good
fan Alan walker , Happy Valentine's Day! 💖
fan Alan walker happy day
Thanks Ms Nandalal kundu
Kacper Lewczuk thanks