- 11
- 59 368
Nova
Приєднався 25 лип 2017
i like trains
Gods Will || I escaped death over 5 times.
I'm getting evicted, like and subscribe so I can pay my babft bills.
Переглядів: 94
Відео
Gorilla Tag
Переглядів 67Місяць тому
This is my first video but be expecting shorts and more videos holy moly :O #gorillatag #gorillatagjuke #gorrilla
Raldi's Crackhouse Ost: Corrupted Player.
Переглядів 691Місяць тому
(NOT OFFICAL) If the owner of this song wants me to take this down I will. This took me forever because I kept getting the soundtrack playing wrong as I had to manually go into the battle and record it. So please consider subscribing because I did that for you guys 😭😭
Caseoh's Basics Sountrack: Big Mac
Переглядів 54 тис.Місяць тому
Caseoh's Basics Soundtrack: Big Mac If the creator of the song wants me to to take this down I will. Gameplay credits: www.youtube.com/@UCqaJHnou8OOBwABfU4N0J5Q Caseoh's basics is a Baldi's Basics mod where your in a mall and you have to collect money to gain calories, after you do all of that you have to fight caseoh by throwing salads at him.
Murder Mystery Funny Moments (RANDOM)
Переглядів 79Рік тому
This is just for fun, credits to all the creator's of the memes! Hope you have a wonderful day and, SUBSCRIBE.
Bro this is eom crazy editing skill man!
BEST SONG I'VE EVER HEARD🔥🔥🔥
woah
The soundtrack is called Big Mac when it's playing a remix of Burger King music
First
Caseoh's theming athem:
THIS AIN’T FIRE, THIS IS FLAME GRILLED 🔥🔥🔥🥶🥶🥶🍔🍔🍔
1:16 pizza tower lap 2 reference?
unironically goes hard
Do we need headphones?
WHOEVER MADE THIS COOKED! and caseoh ate
스킨이 예쁘네요❤
0:44
Finally after 3 months, I found it!!!
You're* But nonetheless cool edit
0:00 - 0:44 looks like a meme because its in 360p as the max quality
Uh oh
omg you converted it to mp3 the way i did :O
Well, nice soundtrack. I wonder if the guy who named the soundtrack even listened to the music.
God dayum bro this kids crazy.
😮😂
YO THIS SHI IS 💥💥🕺🏻🕺🏻🕺🏻🍔🍔🍔🍔
You should’ve add like, the screen glitching a bit, but still good work buddy
I did the like glitching stuff was me.
@@NovaGamesLOLoh my bad, I like your videos
bkfaftfrttttttttyrqareeeeeeyrserwwaasreaewa23ááaaaaaaaaaaaaaaaaaaereeeeeeddeddddddddeees😂wawafgfdsaaaaaskyeysaeeeaawaaawasgdfdfffway..my..way
wy..way
GF:"If you and Silly Billy were to do a Rap Battle, who would win?" BF:"Well if Silly Billy was to use his Domain Expansion: Silliest Billy, it might cause me a little trouble.. GF:"But would you lose?" BF:"Nah, I'd rap." BF:"Are you Billy because you're silly or are you silly because you're Billy?" Silly Billy:"Throughout the Sillys and the Billys, I alone am the Silly Billy. Domain Expansion: Silliest Billy. Silly Technique: MY WAYYYYY!!!!"🗣️🗣️🗣️🌌🌌🌌🌌 BF: 💥
I got goosebumps when I saw this😅
aaaaaa fofo
ill maaaake you sayyyyyyy how proudddd you are of me so stayyyyyyyy aawaaaakeee just looooooong enough to see....MY WAYYYYYYYYYY...........my wayyyyyyyyyyyy..............
Me when i got q good report card:
MY WAY
Schoolhouse Trouble? No. Crackhouse Trouble? No. Whopping Trouble? Yes.
Pov: caseoh is chasing you and gonna eat you
┗|｀O′|┛it's so good
i have monkeys in basement
I would love if Caseoh ate parts of the map as time goes on
you would be able to escape easier, or is case blocking the way?
@@thatonefrankie Like ishann blocking parts of the map but instead eating it but nothing so it makes it impossible
caseoh should've became a 1x1 lego brick and started throwing lego bricks at you slowing you down making a lego brick breaking sound lol
This should be a friday night funkin mod
Blocked
big trouble at mac
Do you make these?! If so what do you use? This is awesome!
I just go to the game, and find the battle which takes me 6 - 8 hours because I have to get a new save to do this I think, so yeah.
New subscriber!
Raldi's Crackhouse ahhhh beat 🗣🗣🗣🗣🗣🔥🔥🔥🔥🔥🔥
one guy in the raldi's crackhouse team made this game so thats why (talking about ronezkj041 or smth)
ronezkj041 boutta get banned ahhhh beat 🗣🗣🗣🗣🗣🔥🔥🔥🔥🔥
this song is amazing! inside my mind: sans last breath phase 2
your good take a sub been watching some of your shorts
Sorry for the lag in the middle, for some reason it did that.
Where did you get that caseoh sprite
The game?
Yes@@AFish2147
Who knew that throwing salads at a quarter pounder would be the most hype thing known to man?
WHY IS THIS SO FIRE 🔥????
🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗🥗 Edit: I’m getting banned 💀
CaseOh is blocked and banned